DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and Nrt

DIOPT Version :9

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster


Alignment Length:548 Identity:133/548 - (24%)
Similarity:198/548 - (36%) Gaps:141/548 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVSLLLVLQSVVESRVRGRQYDEEKDTIVELPTLGSIQGKILETAWTKREVLQFVDVRYAEPPTG 72
            ::..:|..:::....:|..:|      |:.:...|.::|...:.|:.      |..:.||:||..
  Fly   340 VIGYVLTHETLTSPPLREGRY------IMAVTGCGPVEGVKEDGAFA------FRGIPYAKPPVD 392

  Fly    73 LHRFKAPRPIEP----WEDVMDATAEKIGCPSVVSMDSLRRLDDVLDV--EDCLTMTITTPNV-- 129
            ..|:|....|:.    |.|.:......:.|        .:||.:...|  ||||.:.:.||:|  
  Fly   393 RLRWKPAELIDDINMCWNDTLQTHNSSVVC--------TQRLGNGTTVGDEDCLYLDVVTPHVRY 449

  Fly   130 TSRLPVLVYIHGEYLYEGSNSEAPPD--YLLEKDVVLVTPQYRLGPFGFLS----TKTDEIP--G 186
            .:.|||:|.|..|.|...|.....|.  |....||:.|.|.:|||.||||:    ||....|  |
  Fly   450 NNPLPVVVLIGAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSG 514

  Fly   187 NAGFLDIFLALQFVKHFIKYFGGDPSRVTVAGQVGGAAIAHLLTLSPVVQRGLFHQVIYHSGSAI 251
            |....||...|.::|..|.:|||||..||:.|...||.:..||..|..| :||:.:....|||||
  Fly   515 NYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKV-KGLYTRAWASSGSAI 578

  Fly   252 MPIFLEEDPRKHAQEIAKKADCKMVTVR--DLNTCLMELTALELLTAFMEHALEKSDLGIGHTGG 314
            :       |.|...|..|:.:..|.|:.  |:. ||.|.::..|..|..:..|.           
  Fly   579 L-------PGKPLSESGKQNEQLMATLECADIQ-CLREASSERLWAATPDTWLH----------- 624

  Fly   315 IQFTIGGPSGVLPKHPYDL--MLETNFSYPAMGGCPKNAGSRVLNEIVDNDFEGKIPDDEYNTYN 377
                          .|.||  ..|.|.|           |||....::|.|...:.|.|.:    
  Fly   625 --------------FPVDLPQPQEANAS-----------GSRHEWLVLDGDVVFEHPSDTW---- 660

  Fly   378 YIDHVIRQTVGTDKTMLLTSFVTHDFFNRNL---------------MEN------GTFDTLIPR- 420
                  ::....||.:|:.....|:.....|               :||      |..|.:|.: 
  Fly   661 ------KREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKY 719

  Fly   421 -------LIDVAGTLNHKLPVLLALN---------MNNKHNPDNTFLYSFDYAGEFNRYKEMDEE 469
                   |:.:...:....|:|....         :.....||.......|......||   :..
  Fly   720 NASSYASLVSIISDIRSVCPLLTNARQQPSVPFYVVTQGEGPDQLATVDADVQAILGRY---EPH 781

  Fly   470 TNLQSPFKAGVSLTDEALYLFPYPEHVT 497
            |..|..|   ||...:..|.  |..|.|
  Fly   782 TVEQRRF---VSAMQQLFYY--YVSHGT 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 31..558 CDD:278561 130/525 (25%)
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 129/520 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.