DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and Jhedup

DIOPT Version :9

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_611085.2 Gene:Jhedup / 36779 FlyBaseID:FBgn0034076 Length:559 Species:Drosophila melanogaster


Alignment Length:525 Identity:146/525 - (27%)
Similarity:234/525 - (44%) Gaps:82/525 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LPTLGSIQGKILETAWTKREVLQFVDVRYAEPPTGLHRFKAPRPIEPWEDVMDATAEKIGCPSVV 102
            |..:|.::|.:: ..:...|...|:.:.:|:||.|..|.|.|.|.||||.|:||.|.|..|   :
  Fly    24 LEDMGCMRGTLM-PGYQSGEFEAFMGIPFAQPPVGPLRLKNPVPNEPWEGVLDAGAAKDSC---I 84

  Fly   103 SMDSLRRLDDVLDVEDCLTMTITTP--NVTSRLPVLVYIHGEYLYEGS--NSEAPPDYLLEKD-V 162
            ......:...::.|||||.:.:..|  ....:|||:|||||...:.||  ...:.|:||::.: |
  Fly    85 QRSYFAKEWGLMGVEDCLYLNVYRPKNRAEDKLPVMVYIHGGGFFSGSAHPMASGPEYLMDTNKV 149

  Fly   163 VLVTPQYRLGPFGFLSTKTDEIPGNAGFLDIFLALQFVKHFIKYFGGDPSRVTVAGQVGGAAIAH 227
            |:||..|||||||||||..:.:|||.||.|..||||:::..|..|||||.:|||.|...|...||
  Fly   150 VMVTMNYRLGPFGFLSTGDEHMPGNFGFKDQRLALQWIQKHIATFGGDPKKVTVLGHSAGGISAH 214

  Fly   228 LLTLSPVVQRGLFHQVIYHSGSAIMPIF-LEEDPRKHAQEIAKKA---DCKMVTVRDL-----NT 283
            |..:|| ..:|||...:..:|:..:... :.:||...|:.:.|:.   ..:.::.:||     |.
  Fly   215 LHMISP-NSKGLFQNSMSLTGTMFLSAMKILKDPLSQARRLGKELAIDQAESLSSQDLAEALRNV 278

  Fly   284 C----------------LMELTALELLTAFMEHALEKSDLGIGHTGGIQFTIGGPSGVLPKHPYD 332
            |                :..||.|.:|.|....|....|....|.          :|.:.:.|:.
  Fly   279 CPKKLLVSVDSLKVWDNMPHLTTLPVLEAPSPDAFLVEDPLDAHR----------AGRINQMPWI 333

  Fly   333 LMLETNFSYPAMGGCPKNAGSR-VLNEIVDNDFEGKIPDDEYNTYNYIDH---VIRQTVGTDKTM 393
            |.|.:.          ...||. ::...::.....     |:|. |:::|   ::....||...|
  Fly   334 LSLSSR----------AGEGSLFIMRAFINPKLRA-----EFNE-NFLEHMALLLNLPEGTPVQM 382

  Fly   394 LLTSFVTHDFFNRNLMENGTFDTLIPRLIDVAGTLNHKLPVLLALN-----MNNKHNPDNTFLYS 453
            :......:||...:|..    ||:: :|.:::|..|...|:...::     .|.:.||  .|:|.
  Fly   383 VSEILDAYDFKGDSLNN----DTML-KLAEISGDFNFYYPIYETISSYVTYANLEENP--LFIYI 440

  Fly   454 FDYAGEFNRYKEMDEETNLQSPFKAGVSLTDEALYLFPYPEHVTRLSR--PDQSMAHRMVELWTN 516
            |::|| .|...:....|.  ..:..|....|:.|:....|.......:  .|..:..||..|.|:
  Fly   441 FEFAG-LNSITKFFAGTT--DDYGLGAVHMDDGLHTIRIPVSFDDFPKDSEDAKVIQRMSSLMTD 502

  Fly   517 FVISG 521
            |..:|
  Fly   503 FAKTG 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 31..558 CDD:278561 146/525 (28%)
JhedupNP_611085.2 COesterase 31..508 CDD:278561 144/518 (28%)
Aes <106..>210 CDD:223730 49/103 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440396
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.