DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and CG4382

DIOPT Version :9

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster


Alignment Length:645 Identity:173/645 - (26%)
Similarity:256/645 - (39%) Gaps:178/645 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WQIVSLLLVLQSVVESRVRGRQYDE--------EKDTI---------VELPTLGSIQGKILETAW 53
            |::...:|:|..:..    |:..||        |:|.|         |....||.|:|.||.:. 
  Fly     2 WRLCGFVLLLCGLAS----GQNSDEDLSKAIPDEEDPIGSNKELSDLVITTALGKIRGTILPSQ- 61

  Fly    54 TKREVLQFVDVRYAEPPTGLHRFKAPRPIEPWEDVMDATAEKIGCP--SVVSMDSLRRLDDVLDV 116
            :.|....|..:.||:||....||:.|.|:|.|.|.:|||.:...||  .:||.|.         .
  Fly    62 SGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDATFDGPKCPQLGLVSGDV---------S 117

  Fly   117 EDCLTMTITT--------PNVTSRLPVLVYIH--GEYLYEG-SNSEAPPDYLLEKDVVLVTPQYR 170
            ||||.:.|.|        |||  |.||:|:||  |.|...| |.:.|.|.|.:.:.:||||..||
  Fly   118 EDCLRVNIYTKELPSESQPNV--RRPVIVFIHPGGFYSLSGQSKNFAGPQYFMNRRLVLVTFNYR 180

  Fly   171 LGPFGFLSTKTDEIPGNAGFLDIFLALQFVKHFIKYFGGDPSRVTVAGQVGGAAIAHLLTLSPVV 235
            ||..|||:|.|.|.|||.|..|....|::||..|..||||||.:|:.|...||....|..:|| :
  Fly   181 LGSLGFLATGTREAPGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAMAVTLHMVSP-M 244

  Fly   236 QRGLFHQVIYHSGSAIMPIFLEEDPRKHAQEIAKK----ADCKMVTVRDLNTCLMELTALELLTA 296
            .|||||:.|..||:......|.:    |..::|.|    ..|....|.::..||..         
  Fly   245 SRGLFHKAIVMSGAVTGQWSLPD----HQMDVATKQATLLHCHTENVTEMMDCLKG--------- 296

  Fly   297 FMEHALEKSDLGIGHTGGIQFTIGGPSGVLPKHPYDLMLETNFSYPAMGGCPKNAGSRVLNEIVD 361
              :|.||.::                  .|||     |.|.:.:.|.:          :...:::
  Fly   297 --KHYLEFAN------------------TLPK-----MFEFDRNNPLI----------LWKPVIE 326

  Fly   362 NDF--EGKIPDDEYNTYNYIDHVIRQTVGTDKTMLLTSFVTHDFFNRNL----------MENGTF 414
            .||  |..:.::...:|...|.:        |..::|.....:|....|          ..|..|
  Fly   327 PDFGQERFLVEEPIRSYQNDDFM--------KVPIITGMTKDEFVGPALSILQSPTLLSALNENF 383

  Fly   415 DTLIP----------RLIDVAGTL-NHKLP-VLLALN-----MNNKHNPDNT------------- 449
            ::|.|          |..:::..| ||..| .|:..|     ::|.::...|             
  Fly   384 ESLAPVFFMYNTSDARACNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLAAR 448

  Fly   450 ----FLYSFDYAGEFNR--YKEMDEETNLQSPFKAGVSLTDEALYLFPYPEHVTRLSRPDQS--- 505
                :.|.|.|.|..:.  |.|       .:|:  ||...|:.:|||..|. ::|:...|..   
  Fly   449 STKVYYYRFSYQGARSHIYYPE-------DAPY--GVVHHDDLMYLFVEPS-ISRMFTEDDDEFR 503

  Fly   506 MAHRMVELWTNFVISGNP-------LGSARVGYWPPMTTLYGPYMRIDDTMTIGGNYFTE 558
            |...||.:::.|...|:|       |...|   |.|.:.....|:.|...:|:..|...|
  Fly   504 MVDIMVRMFSAFAYKGDPNKPTDLALRDIR---WRPFSFKKRYYLDIGKHITLEENLNAE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 31..558 CDD:278561 166/610 (27%)
CG4382NP_609301.2 COesterase 41..565 CDD:278561 164/602 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467466
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.