DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and AADACL3

DIOPT Version :10

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001096640.2 Gene:AADACL3 / 126767 HGNCID:32037 Length:407 Species:Homo sapiens


Alignment Length:99 Identity:28/99 - (28%)
Similarity:40/99 - (40%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PVLVYIHGEYLYEGS---NSEAPPDYLLEKDVVLVTPQYRLGPFGFLSTKTDEIPGNAGFLDIFL 195
            |.:||.||.....||   :.........|.|.|::...||            ::|.:...:.:..
Human   113 PGIVYYHGGGGVMGSLKTHHGICSRLCKESDSVVLAVGYR------------KLPKHKFPVPVRD 165

  Fly   196 ALQFVKHFIK---YFGGDPSRVTVAGQVGGAAIA 226
            .|....||:|   .:|.||:||.|.|...|.|||
Human   166 CLVATIHFLKSLDAYGVDPARVVVCGDSFGGAIA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 33..558 CDD:395084 28/99 (28%)
AADACL3NP_001096640.2 Abhydrolase_3 115..378 CDD:400284 27/97 (28%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121 1/1 (100%)

Return to query results.
Submit another query.