DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9287 and Cel

DIOPT Version :9

Sequence 1:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_034015.1 Gene:Cel / 12613 MGIID:88374 Length:599 Species:Mus musculus


Alignment Length:572 Identity:147/572 - (25%)
Similarity:229/572 - (40%) Gaps:130/572 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LGSI--QGKILETAWTKREVL--QFVDVRYAEPPTGLHRFKAPRPIEPWEDVMDATAEKIGCPSV 101
            ||::  :|..:|....|..:|  ..||:....|.......:.|:....|:..:.||..|..|   
Mouse    23 LGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHPGWQGTLKATNFKKRC--- 84

  Fly   102 VSMDSLRRLDDVLDVEDCLTMTITTP----NVTSRLPVLVYIHG---------------EYLYEG 147
              :.:....|:....||||.:.|..|    .|:..|||:|:|:|               .|||:|
Mouse    85 --LQATITQDNTYGQEDCLYLNIWVPQGRKQVSHNLPVMVWIYGGAFLMGSGQGANFLKNYLYDG 147

  Fly   148 SNSEAPPDYLLEKDVVLVTPQYRLGPFGFLSTKTDEIPGNAGFLDIFLALQFVKHFIKYFGGDPS 212
            .      :.....:|::||..||:||.|||||....:|||.|..|..:|:.:||..|..|||||.
Mouse   148 E------EIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPD 206

  Fly   213 RVTVAGQVGGAAIAHLLTLSPVVQRGLFHQVIYHSGSAIMPIFLEEDPRKHAQEIAKKADCKMVT 277
            .:|:.|:..|||...|.|||| ..:||..:.|..||.|:.|..::::|...|:.||||..|....
Mouse   207 NITIFGESAGAASVSLQTLSP-YNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTED 270

  Fly   278 VRDLNTCLMELTALELLTAFMEHALEKSDLGIGHTGGIQFTIGGPSGVLPKHPYDLMLETNFSYP 342
            ...:..|| ::|....||...:..::|.:..:.|                             |.
Mouse   271 TGKMAACL-KITDPRALTLAYKLPVKKQEYPVVH-----------------------------YL 305

  Fly   343 AMGGCPKNAGSRVLNEIVDNDFEGKIPDDEYNTYNY---IDHV---------------------I 383
            |.  .|          ::|.||   ||||..|.||.   ||::                     .
Mouse   306 AF--IP----------VIDGDF---IPDDPINLYNNTADIDYIAGINNMDGHLFATIDVPAVDKT 355

  Fly   384 RQTVGTDKTMLLTS-----------FVTHDFFNRNLMENGTFDTLIPRLIDVAGTLNHKLPVLLA 437
            :|||..:....|.|           ..|.|.:..:..::.:.:.:...::.....:...:|..:|
Mouse   356 KQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYTESWAQDPSQENMKKTVVAFETDVLFLIPTEIA 420

  Fly   438 LNMNNKH-NPDNTFLYSFDYAGEFNRYKEMDEETNLQSPFKAGVSLTDEALYLFPYPEHVTRLSR 501
            |..:..| ....|:.|.|.:......|           |...|....|:..|:|..|.......|
Mouse   421 LAQHKAHAKSAKTYSYLFSHPSRMPIY-----------PKWMGADHADDLQYVFGKPFATPLGYR 474

  Fly   502 P-DQSMAHRMVELWTNFVISGNP-LGSARV-GYWPPMTTLYGPYMRIDDTMT 550
            | |::::..|:..||||..||:| :|::.| .:|.|.|...|.|:.|..|:|
Mouse   475 PQDRAVSKAMIAYWTNFARSGDPNMGNSPVPTHWYPYTLENGNYLDITKTIT 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9287NP_609244.1 COesterase 31..558 CDD:278561 147/572 (26%)
CelNP_034015.1 COesterase 26..542 CDD:278561 145/569 (25%)
Aes <117..>247 CDD:223730 52/136 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..599
4 X 11 AA tandem repeats, O-glycosylated region 559..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.