DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and CXE5

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_175389.1 Gene:CXE5 / 841390 AraportID:AT1G49660 Length:319 Species:Arabidopsis thaliana


Alignment Length:245 Identity:55/245 - (22%)
Similarity:99/245 - (40%) Gaps:67/245 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PNCAQFPE--LDRLRLSESRGENVD---DCLTLD-IYAPE-----------------GANQLPVL 162
            |.|..:.:  ::||..:::...::|   |.::.| ||:||                 ..|:||:|
plant    11 PFCRIYKDGRVERLIGTDTIPASLDPTYDVVSKDVIYSPENNLSVRLFLPHKSTKLTAGNKLPLL 75

  Fly   163 VFVHG-----EMLFDGGSEEAQPDYVLEKDVLLVSINYRLAPFGFLSALTDELPGNVALSDLQLA 222
            :::||     |..|.........:.|...:.|.||:.||.||         |.|...|..|:..|
plant    76 IYIHGGAWIIESPFSPLYHNYLTEVVKSANCLAVSVQYRRAP---------EDPVPAAYEDVWSA 131

  Fly   223 LEWLQRNVVHFGGNA-----------GQVTLVGQAGGATLAHALSL-SGRAGNLFQQLILQSGTA 275
            ::|:   ..|..|:.           |:|.|.|.:.|..::|.::: :|:...|  .|.::....
plant   132 IQWI---FAHSNGSGPVDWINKHADFGKVFLGGDSAGGNISHHMAMKAGKEKKL--DLKIKGIAV 191

  Fly   276 LNPYLIDNQPLD--------TLSTFARLAR--CPPPSINPSAQGLKPLYD 315
            ::|......|:|        |.|..|.:..  ..|.|:|.:..   ||::
plant   192 VHPAFWGTDPVDEYDVQDKETRSGIAEIWEKIASPNSVNGTDD---PLFN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 55/245 (22%)
Aes <146..345 CDD:223730 49/215 (23%)
RILP-like <677..>717 CDD:304877
CXE5NP_175389.1 Aes <55..277 CDD:223730 44/201 (22%)
Abhydrolase_3 75..278 CDD:285143 41/181 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.