DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AT1G49640

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_175387.1 Gene:AT1G49640 / 841388 AraportID:AT1G49640 Length:315 Species:Arabidopsis thaliana


Alignment Length:160 Identity:35/160 - (21%)
Similarity:69/160 - (43%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DDCLTLDIYAPE-------GANQLPVLVFVHG-----EMLFDGGSEEAQPDYVLEKDVLLVSINY 195
            |..|::.::.|.       ..|::|:|::.||     :..|.........:.|:..:.|.||:.|
plant    51 DHNLSVRMFLPNKSRKLDTAGNKIPLLIYFHGGAYIIQSPFSPVYHNYLTEVVITANCLAVSVQY 115

  Fly   196 RLAPFGFLSALTDELPGNVALSDLQLALEWL---QRNVVHFGGNAGQVTLVGQAGGATLAHALSL 257
            ||||         |.|...|..|...|::|:   ..:.::...:..:|.:.|.:.||.::|.:.:
plant   116 RLAP---------EHPVPAAYDDSWSAIQWIFSHSDDWINEYADFDRVFIAGDSAGANISHHMGI 171

  Fly   258 SGRAGNLFQQLILQSGTALNPYLIDNQPLD 287
              |||.......::....::|.....:|:|
plant   172 --RAGKEKLSPTIKGIVMVHPGFWGKEPID 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 35/160 (22%)
Aes <146..345 CDD:223730 34/157 (22%)
RILP-like <677..>717 CDD:304877
AT1G49640NP_175387.1 Aes 11..274 CDD:223730 35/160 (22%)
Abhydrolase_3 77..294 CDD:285143 30/134 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.