DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AT1G19190

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_173353.1 Gene:AT1G19190 / 838502 AraportID:AT1G19190 Length:318 Species:Arabidopsis thaliana


Alignment Length:299 Identity:70/299 - (23%)
Similarity:118/299 - (39%) Gaps:75/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LTLDIYAPE------GANQLPVLVFVHGEMLFDGG--SEEA-QPDY-------VLEKDVLLVSIN 194
            |:|.||.|:      |..::|:||:.||     ||  .|.| .|.|       |...|.:.||:.
plant    53 LSLRIYLPQNSVYETGEKKIPLLVYFHG-----GGFIMETAFSPIYHTFLTSAVSATDCIAVSVE 112

  Fly   195 YRLAPFGFLSALTDELPGNVALSDLQLALEWLQRNVVHFG--------GNAGQVTLVGQAGGATL 251
            ||.||         |.|......|...|::|:..::...|        .:..:|.|.|.:.||.:
plant   113 YRRAP---------EHPIPTLYEDSWDAIQWIFTHITRSGPEDWLNKHADFSKVFLAGDSAGANI 168

  Fly   252 AHALSLSGRAGNLFQQLILQSGTAL-NPY-----LIDNQPLDTLSTFARLARCPPPSINPSAQGL 310
            ||.:::......|..:....||..| :||     ||:...::.:..:.||.|...|.   |..|:
plant   169 AHHMAIRVDKEKLPPENFKISGMILFHPYFLSKALIEEMEVEAMRYYERLWRIASPD---SGNGV 230

  Fly   311 KPLYDCLARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLVV----GDPL---GFLPSHPASLATN 368
            :.        |...:|.:           .||.||..:::|    .|.|   |:  |:.|.|..:
plant   231 ED--------PWINVVGS-----------DLTGLGCRRVLVMVAGNDVLARGGW--SYVAELEKS 274

  Fly   369 SSLALPMIIGATKDASAFIVSRIYDQLARLQSRNVSDYI 407
            ..:....::...::...|.:.....:.||...||.::::
plant   275 GWIGKVKVMETKEEGHVFHLRDPDSENARRVLRNFAEFL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 70/299 (23%)
Aes <146..345 CDD:223730 56/228 (25%)
RILP-like <677..>717 CDD:304877
AT1G19190NP_173353.1 Abhydrolase_3 75..293 CDD:400284 58/255 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.