DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and CXE20

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_201024.1 Gene:CXE20 / 836339 AraportID:AT5G62180 Length:327 Species:Arabidopsis thaliana


Alignment Length:236 Identity:58/236 - (24%)
Similarity:94/236 - (39%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AQPIGYQGRVNATVQS--------PNCAQFPELDRLRLSESRGENVDDCLT--LDIYAPEGA--- 156
            |.|..|...||....|        |..|..|:...|..:.|:...|:...:  |.:|.|..|   
plant     8 ADPYAYLNIVNNPDGSITRDLSNFPCTAATPDPSPLNPAVSKDLPVNQLKSTWLRLYLPSSAVNE 72

  Fly   157 -----NQLPVLVFVHG----------EMLFDGGSEEAQPDYVLEKDVLLVSINYRLAPFGFLSAL 206
                 .:||::|:.||          ::..|..||.|:     :.:.::||.:|||||...|.|.
plant    73 GNVSSQKLPIVVYYHGGGFILCSVDMQLFHDFCSEVAR-----DLNAIVVSPSYRLAPEHRLPAA 132

  Fly   207 TDELPGNVALSDLQLA-LEWLQRNVVHFGGNAGQVTLVGQAGGATLAHALSLSGRAGNLFQQLIL 270
            .|:  |..||..::.: .||::.:     .:...|.|:|.:.|..||:.:.|..          :
plant   133 YDD--GVEALDWIKTSDDEWIKSH-----ADFSNVFLMGTSAGGNLAYNVGLRS----------V 180

  Fly   271 QSGTALNPY----LIDNQPL----DTLSTFARLAR---CPP 300
            .|.:.|:|.    ||.:.|.    :...:..||..   |||
plant   181 DSVSDLSPLQIRGLILHHPFFGGEERSESEIRLMNDQVCPP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 58/236 (25%)
Aes <146..345 CDD:223730 46/187 (25%)
RILP-like <677..>717 CDD:304877
CXE20NP_201024.1 Abhydrolase_3 83..303 CDD:369561 40/161 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.