DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and CXE16

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_568298.1 Gene:CXE16 / 831281 AraportID:AT5G14310 Length:446 Species:Arabidopsis thaliana


Alignment Length:246 Identity:57/246 - (23%)
Similarity:86/246 - (34%) Gaps:90/246 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PNCAQFPELDRLR----------------------------LSESR----GENVDDCLTLDIYAP 153
            |..|..||.|.||                            .:|||    |.|.::......|||
plant    78 PESALSPEPDSLRHKDNYNHQPRSDRRHSYGPNHNSPAPAERNESRRNSYGCNNENLEPYGGYAP 142

  Fly   154 ---EGANQLPVLVFVHGEMLFDGGSEEAQPDYVLEK-----DVLLVSINYRLAPFGFLSALTDEL 210
               ..:.:|||::..||.....|.|:.|..|:...:     ||:::::.|||||       .:..
plant   143 SAKRNSRKLPVMLQFHGGGWVSGSSDSAANDFFCRRIAKVCDVIVLAVGYRLAP-------ENRY 200

  Fly   211 PGNVALSDLQLALEWL--QRNVVHF----------GGNAGQVTLVGQ---AGGATL------AHA 254
            |  .|..|....|.||  |.|:...          |....::.:.||   |.||::      |||
plant   201 P--AAFEDGVKVLHWLGKQANLADCCKSLGNRRVNGVEVKKLNVQGQIVDAFGASMVEPWLAAHA 263

  Fly   255 ---------LSLSG-----------RAGNLFQQLILQSGTALNPYLIDNQP 285
                     :|..|           .||.|.:.:.:.:...:.|:.|.|.|
plant   264 DPSRCVLLGVSCGGNIADYVARKAVEAGKLLEPVKVVAQVLMYPFFIGNNP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 57/246 (23%)
Aes <146..345 CDD:223730 45/189 (24%)
RILP-like <677..>717 CDD:304877
CXE16NP_568298.1 Abhydrolase 85..>213 CDD:419691 32/136 (24%)
Abhydrolase_3 154..411 CDD:400284 39/170 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.