DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AT2G45610

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_182085.1 Gene:AT2G45610 / 819169 AraportID:AT2G45610 Length:324 Species:Arabidopsis thaliana


Alignment Length:317 Identity:70/317 - (22%)
Similarity:113/317 - (35%) Gaps:103/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 VNATVQSPN--CAQF-------PELD----RLRLSESRGENVDDCLTLDIYAP-------EGANQ 158
            :|.|: :||  |.:.       |:.|    :|..|:....|.:..:::.|:.|       ....:
plant    15 LNITI-NPNGSCTRHFVWPRVEPDPDPCPGKLAASKDVTINHETGVSVRIFRPTNLPSNDNAVAR 78

  Fly   159 LPVLVFVHGE--MLFDGGS---EEAQPDYVLEKDVLLVSINYRLAPFGFLSALTDELPGNVALSD 218
            ||:::.:||.  :|:...|   :........|..|::||::|||.|...|.|..|:     ||. 
plant    79 LPIIIHLHGSGWILYPANSAANDRCCSQMASELTVIVVSVHYRLPPEHRLPAQYDD-----ALD- 137

  Fly   219 LQLALEWLQRNVVHFG---------GNAGQVTLVGQAGGATLAHALSLSGRAGNLFQQLILQSGT 274
               ||.|:::.||...         .:..:..:.|.:.||.:|            ||..:.....
plant   138 ---ALLWVKQQVVDSTNGEPWLKDYADFSRCYICGSSNGANIA------------FQLALRSLDH 187

  Fly   275 ALNPYLIDN----QPLDTLSTFARLARCPPPSINPSAQGLKPLYDCLARLPTSQLVAAFEQLLLQ 335
            .|.|..||.    |||     |....|        :...||...|.:  :|...:.|.:|     
plant   188 DLTPLQIDGCVFYQPL-----FGGKTR--------TKSELKNFADPV--MPVPAVDAMWE----- 232

  Fly   336 NEHLGLTQLGGFKLVVG--------DPLGFLPSHPASLATNSSLALPMIIGATKDAS 384
                       ..|.||        :|||:||.....    ..|...::||...|.|
plant   233 -----------LSLPVGVDRDHRYCNPLGYLPQKEKV----GRLGRCLVIGYGGDTS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 70/317 (22%)
Aes <146..345 CDD:223730 47/223 (21%)
RILP-like <677..>717 CDD:304877
AT2G45610NP_182085.1 Aes 57..323 CDD:223730 60/274 (22%)
Abhydrolase_3 82..303 CDD:285143 56/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.