DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and ptgr2

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001072802.1 Gene:ptgr2 / 780263 XenbaseID:XB-GENE-995226 Length:347 Species:Xenopus tropicalis


Alignment Length:218 Identity:40/218 - (18%)
Similarity:64/218 - (29%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 SLQTVAPGLLE--LSNYI----LYRAPVINSISQSYRSVPAYLYTFDYRGEHHRFGHLSNPLPFG 499
            |||.:.|.|::  :|||:    |.....:..|.:....:|....|....|.....|.|:..    
 Frog   113 SLQKLDPSLVDGHISNYLGAVGLTGLTALIGIKEKGHVIPGANQTMVVSGAAGACGSLAGQ---- 173

  Fly   500 VDASLSDDSVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVPNPSSGVWPQATSEYGPFLR 564
            :...|...::.......:..:|...|.....|     ||:...|:........|.....|     
 Frog   174 IGRILGCSNIVGICGTEQKCKLLVSDLGFDSA-----VNYKEYGLDEKLRACCPNGVDVY----- 228

  Fly   565 FTN-------------NQQSPLELDPHFGEGIYLPNYRVIYKPTTNFSPPITTTTTTTTTTTTTS 616
            |.|             ||.|.:.|.....:          |....::.||:...|.........:
 Frog   229 FDNVGGEISDKVIHQMNQNSHIILCGQISQ----------YNKDVSYPPPLHAETAAILKQRNIT 283

  Fly   617 RP-YAYNPYANWQNRPSQQHPNW 638
            |. :....||:..|....|...|
 Frog   284 RERFLVLTYADQHNSAIVQLSQW 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 30/156 (19%)
Aes <146..345 CDD:223730
RILP-like <677..>717 CDD:304877
ptgr2NP_001072802.1 PTGR2 1..345 CDD:176253 40/218 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.