DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and angptl3

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001011408.1 Gene:angptl3 / 496885 XenbaseID:XB-GENE-6258790 Length:456 Species:Xenopus tropicalis


Alignment Length:152 Identity:33/152 - (21%)
Similarity:57/152 - (37%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 ELEERIRQQQEREQYEREQQEREQREREELERQQREREQQQPEQQPEYNPEPVNPWGYPVQEPQP 777
            :|.|:..:.:|:|:..::...:.|...|||:...|:...|                   |:....
 Frog    81 DLSEQTNEIREKEEELKDTTSKLQENNEELKNISRKINSQ-------------------VENLLQ 126

  Fly   778 DD---NPEDGRLPYPSYE--QYGPEGNENLPETDANRNFSEEDREQQQQEQLRREQQEQQEREYQ 837
            |.   ..:.|.|....::  |...||.| :.|..:.:||.|     ||...:|...:..||:..|
 Frog   127 DKIHLQAKVGSLEEKLFQMTQGTTEGQE-IKEISSLKNFVE-----QQDVNIRHLLKVVQEQHMQ 185

  Fly   838 L--------QLEREQQEREQQE 851
            |        .||.:..:.:.||
 Frog   186 LDHQNVQIKDLEDKLSKADLQE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561
Aes <146..345 CDD:223730
RILP-like <677..>717 CDD:304877 1/3 (33%)
angptl3NP_001011408.1 SMC_N <58..>206 CDD:330553 31/149 (21%)
FReD 239..447 CDD:238040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.