DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and nceh1

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_012818366.1 Gene:nceh1 / 493371 XenbaseID:XB-GENE-959943 Length:409 Species:Xenopus tropicalis


Alignment Length:193 Identity:48/193 - (24%)
Similarity:77/193 - (39%) Gaps:35/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FPELD-----RLRLSESRGENVDDCLTLDIYAPEGA---NQLPVLVFVHGEMLFDGGSEEAQPDY 182
            |.:||     .|:::::    |.|.:.:.|:.|..|   |....:|::||.....|.:.....|.
 Frog    70 FDQLDPVSSEHLKVTDT----VFDGVEVRIFEPTKAFDKNLKKSIVYIHGGGWALGSARMRSYDS 130

  Fly   183 VLEK-----DVLLVSINYRLAP-FGFLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNAGQVT 241
            :..|     :.::|||.|||.| ..|...|.|.    ||.:...|..|.|    ..:..:..::.
 Frog   131 LCRKISEDVNAVVVSIEYRLVPDVHFPEQLNDA----VAATKYFLHPEVL----AEYSVDPSRIA 187

  Fly   242 LVGQAGGATLAHAL--SLSGRAGNL----FQQLI---LQSGTALNPYLIDNQPLDTLSTFARL 295
            :.|.:.|..||.|:  .|:|.:...    .|.||   ||......|....|..:..||.|..:
 Frog   188 VSGDSAGGNLAAAVCQQLAGDSSVTTKVKLQALIYPVLQVLDFNTPSYQQNMDMPILSRFVMI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 48/193 (25%)
Aes <146..345 CDD:223730 42/168 (25%)
RILP-like <677..>717 CDD:304877
nceh1XP_012818366.1 Abhydrolase_3 110..382 CDD:400284 38/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.