DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and aadac

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001004960.1 Gene:aadac / 448381 XenbaseID:XB-GENE-969584 Length:403 Species:Xenopus tropicalis


Alignment Length:311 Identity:70/311 - (22%)
Similarity:113/311 - (36%) Gaps:99/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IYAPEGA--NQLPVLVFVHGEMLFDGG---SEEAQPDY-------VLEKDVLLVSINYRLAP-FG 201
            ::.|:.|  .|...::::||     ||   ...|...|       .|:.|.::|||:||||| |.
 Frog    93 LFIPKAAVTEQRRAVIYIHG-----GGWCLGSSAMKPYDLLGRYTALQLDAVVVSIDYRLAPAFH 152

  Fly   202 FLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNAGQVTLVGQAGGATLAHALSLSGRAGNLFQ 266
            |.:...|.    .|::...|..:.||:    :..:..:|.:.|.:.|..||.|::         |
 Frog   153 FPTQFDDV----YAVTKYFLDKDILQK----YSVDPSRVAVAGDSAGGNLAAAIA---------Q 200

  Fly   267 QL------------------ILQSGTALNPYLIDNQPLDTLS------------TFARL---ARC 298
            ||                  :||......|...||..:..||            |..|.   |..
 Frog   201 QLLNDPEVKVKLKIQALIYPVLQDIDMNTPSYQDNGDMPVLSKSLMVRFWSEYITIDRTLGEAMW 265

  Fly   299 PPPSINPSAQGLKPLYDCLARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLVVGDPLGFLPSHPA 363
            ....|...|:.:....:....||.:          |:.:|:.|....|..       ||:..:||
 Frog   266 HNKHIPAEAEHVLRFVNWSTLLPDN----------LKKQHVYLKSEFGSS-------GFVNKYPA 313

  Fly   364 SLATNSSLALPMIIGATK---DASAFIVSRIYDQL--------ARLQSRNV 403
            .|...:|   |::....|   ..:|:|::.:||.|        |||:...|
 Frog   314 ILDAKAS---PLLAEDEKLKGLPTAYIITCMYDVLRDDGFMYAARLRKAGV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 70/311 (23%)
Aes <146..345 CDD:223730 52/240 (22%)
RILP-like <677..>717 CDD:304877
aadacNP_001004960.1 Abhydrolase_3 107..377 CDD:311692 67/297 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.