DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and alpha-Est2

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:531 Identity:151/531 - (28%)
Similarity:241/531 - (45%) Gaps:86/531 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VVQAPEVGQILGISGHKTIANR-PVNAFLGIRYGTVGGGLARFQAAQ-PIGYQGRVNATVQSPNC 123
            |:...:.||:.|:. .||:.:: |..||.||.|.....|..||:|.| |..:||.:|.|..... 
  Fly    33 VILDTKYGQVRGLQ-RKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSK- 95

  Fly   124 AQFPELDRLRLSESRGENVDDCLTLDIY--APEGANQLPVLVFVHGEMLFDGGSEEAQ------- 179
               |....:.|....|.  :|||.|::|  |.:....|||:|:::|     ||.::.:       
  Fly    96 ---PMQRNMLLGIVEGS--EDCLHLNVYVKALKSEKPLPVIVWIYG-----GGFQKGEASRDIYS 150

  Fly   180 PDYVLEKDVLLVSINYRLAPFGFLSALTD---ELPGNVALSDLQLALEWLQRNVVHFGGNAGQVT 241
            |||.::|.|:.|:||||||..|||| |.|   ::|||..|.|..:||.|:.:|:.||.|:...:|
  Fly   151 PDYFMKKPVVFVAINYRLAALGFLS-LKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNIT 214

  Fly   242 LVGQAGGATLAHALSLSGRAGNLFQQLILQSGTALNPYLIDNQPLDTLSTFARLARCPPPSINPS 306
            |:|::.|:...|.:..:.:...||.:.|:|||.||:.::   :..|....| |||:      |..
  Fly   215 LMGESAGSASVHVMMTTEQTRGLFHKAIMQSGCALSEWV---ESPDNNWAF-RLAQ------NLG 269

  Fly   307 AQGLKPLYDCLARLP--TSQLVAAFEQLLLQNEHLGLTQLGGFKLVVGDPL--------GFLPS- 360
            .:|.:...|.|:.|.  .::.:||.:|     :.:.|.::..|.|....|:        ..:|. 
  Fly   270 YKGDEKDADVLSFLSKVCARQIAAIDQ-----DVINLDEVRSFLLFAFGPVIEPYETDHCVVPKR 329

  Fly   361 HPASLATNSSLALPMIIGATKDASAFIVSRIYDQLARLQSRNVSDYIDVVLRHTAPPSE------ 419
            |...|:......:|:|:|.......|..     ||.|.....:.::.:::.|.....|.      
  Fly   330 HKDLLSEAWGNDIPVIVGGNSFEGLFSY-----QLVRKDPWALKNFHNILPREVRETSSLEGQDL 389

  Fly   420 --HRLWKQWALREIFTPIQEQTASLQTVAPGLL--ELSNYILYRAPVINSISQSYR-SVPAYLYT 479
              .|| ||...........|...:|...:...:  :...:||.|        |||. ..|.|||.
  Fly   390 LVRRL-KQLYFNNEMQESMEMFEALNIFSHRQIWHDTHRFILAR--------QSYAPKTPTYLYR 445

  Fly   480 FDYRGEH-HRFGHL-SNPLPFGVDASLSDDSVYLFPYPPEASRL--NPLDRSLSRALVTMWVNFA 540
            ||:...| ::|..| ......||  :.:|:..||| |...||:|  :.::......:|.||.:||
  Fly   446 FDFDSPHFNQFRRLVCGDRIRGV--AHADELSYLF-YNIIASKLDKSSMEYKTIERMVGMWTSFA 507

  Fly   541 TTGVPN-PSSG 550
            ::|.|| |..|
  Fly   508 SSGNPNCPELG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 151/531 (28%)
Aes <146..345 CDD:223730 68/212 (32%)
RILP-like <677..>717 CDD:304877
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 151/531 (28%)
Aes <117..>221 CDD:223730 42/109 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.