DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AADACL2

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_997248.2 Gene:AADACL2 / 344752 HGNCID:24427 Length:401 Species:Homo sapiens


Alignment Length:332 Identity:63/332 - (18%)
Similarity:119/332 - (35%) Gaps:78/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VDDCLTLDI----YAPEGANQL--PVLVFVHGEMLFDGGSEEAQPDYVLE-----KDVLLVSINY 195
            |.|...:||    |.|:..::.  ..:::.||.....|.|::...|::..     .|.::|.::|
Human    81 VTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAFDFLNRWTANTLDAVVVGVDY 145

  Fly   196 RLAPFGFLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNAGQVTLVGQAGGATLAHALSLSGR 260
            ||||.....|..::     .|:.::..|  |::.:..:|.:..::.:.|.:.|..||.|::...:
Human   146 RLAPQHHFPAQFED-----GLAAVKFFL--LEKILTKYGVDPTRICIAGDSSGGNLATAVTQQVQ 203

  Fly   261 -----AGNLFQQLILQSGTAL-NPYLIDNQPLDTLSTFARLARCPPPSINPSAQGLKPLYDCLAR 319
                 ...:..|::|..|..: :.||                    ||...:..|:....|...:
Human   204 NDAEIKHKIKMQVLLYPGLQITDSYL--------------------PSHRENEHGIVLTRDVAIK 248

  Fly   320 LPTSQLV--AAFEQLLLQNEHLGLTQLGGFKL---------------VVGDPL---------GFL 358
            |.:....  .|....:.:|:|:.|.....||.               |..:|:         |..
Human   249 LVSLYFTKDEALPWAMRRNQHMPLESRHLFKFVNWSILLPEKYRKDYVYTEPILGGLSYSLPGLT 313

  Fly   359 PSHPASLATNSS----LALPMII----GATKDASAFIVSRIYDQLARLQSRNVSDYIDVVLRHTA 415
            .|....|..|.|    |.|..|:    ...:|.....|:|:.:...::...::.|.|...|....
Human   314 DSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQVVHEHIEDGIHGALSFMT 378

  Fly   416 PPSEHRL 422
            .|...||
Human   379 SPFYLRL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 63/332 (19%)
Aes <146..345 CDD:223730 40/217 (18%)
RILP-like <677..>717 CDD:304877
AADACL2NP_997248.2 Aes 77..372 CDD:223730 59/317 (19%)
Abhydrolase_3 107..372 CDD:285143 53/291 (18%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 111..113 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.