DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AgaP_AGAP010914

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_309777.4 Gene:AgaP_AGAP010914 / 3291195 VectorBaseID:AGAP010914 Length:228 Species:Anopheles gambiae


Alignment Length:149 Identity:37/149 - (24%)
Similarity:70/149 - (46%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 ASLQTVAPGLLELSNYILYRAPVINSISQSYRSVP--AYLYTFDYRGEHHRFGHLSNPL----PF 498
            |:...:.|..::::..:..:...:...::..|::|  .|||.|||.|.       .:|:    |:
Mosquito    87 ANFSEIVPLFIDVAGNLALKYGSVEEANRFARALPGQVYLYNFDYVGP-------PSPMTPGFPY 144

  Fly   499 GVDASL--SDDSVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVPNPSSGV-WPQATSEYG 560
            ....|:  .|:..:|||.   ::.||.....:::.:|.:|.:||.||||...:.: ||..:..:|
Mosquito   145 DFPNSVGHGDELKFLFPM---SNVLNEEHTQMAKIMVDLWTSFAITGVPQADNVIPWPAVSRPFG 206

  Fly   561 PFLRFTNNQQSPLELDPHF 579
            |:.|..|    |.|...:|
Mosquito   207 PYFRLVN----PPEQKEYF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 36/147 (24%)
Aes <146..345 CDD:223730
RILP-like <677..>717 CDD:304877
AgaP_AGAP010914XP_309777.4 Abhydrolase <2..202 CDD:304388 30/124 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D40753at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.