DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and cel.1

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_955901.2 Gene:cel.1 / 322481 ZFINID:ZDB-GENE-030131-1201 Length:550 Species:Danio rerio


Alignment Length:585 Identity:146/585 - (24%)
Similarity:239/585 - (40%) Gaps:107/585 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QAPEVGQILGISGHKTIANRPVNAFLGIRYGTVGGGL------ARFQ--AAQPIGYQGRVNATVQ 119
            |...:|.:|...|.....:|.|..|   ||.....|:      .||:  .|.| |::|.:..|..
Zfish    18 QGASLGAVLTEGGMVQGKSRSVGLF---RYMDTFKGIPFAAPPKRFEKPVAHP-GWEGVLKTTDY 78

  Fly   120 SPNCAQFPELDRLRLSESRGENVDDCLTLDIYAPEG---ANQLPVLVFVHGEMLFDGGSEEAQ-- 179
            ...|.|      |.|..:.....:|||.|:|:.|:|   ::.|||:||::|.....||.:.|.  
Zfish    79 RKRCLQ------LNLLATDVIGSEDCLYLNIWVPQGRTVSSNLPVMVFIYGGAFLLGGGQGANFL 137

  Fly   180 PDYVLEKD-------VLLVSINYRLAPFGFLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNA 237
            .:|:.:.:       |::|:.|||:...||:|...|.:|||..|.|...|:.|:.||:..||||.
Zfish   138 DNYLYDGEEMADRGNVIVVTFNYRVGALGFMSTGDDGIPGNYGLWDQHAAISWVHRNIKAFGGNP 202

  Fly   238 GQVTLVGQAGGATLAHALSLSGRAGNLFQQLILQSGTALNPYLIDNQPLDTLSTFARLARCPPPS 302
            ..:||.|::.||...:...::.:...:.::.|.|||.||.|:.|...|.......|....||..|
Zfish   203 DNITLFGESAGAASVNFQIITPKNKGMIRRAISQSGVALCPWAISRNPRQFAEEIATKVGCPIDS 267

  Fly   303 INPSAQGLKPLYDCLARLPTS--------QLVAAFEQLLLQNEHLGLTQLGGFKLVVGDPLGFLP 359
                     .:.|||.|....        :|.::.:..::.|.:|.       .::.||   |:|
Zfish   268 ---------GMADCLKRADPKAVTLAGKLKLTSSPDAPIVHNLYLS-------PVIDGD---FIP 313

  Fly   360 SHPASLATNSSLALPMIIGAT-KDASAFI---VSRIYDQLARLQSRNVSDYIDVVLRHTAPPSEH 420
            ..|.:|..|:: .:..|.|.. .||..|.   :..|.:.|.......|......:.|.....:..
Zfish   314 DEPETLFGNAA-DIDYIAGVNDMDAHIFATIDIPSINNALTTTPVEEVQALATALSRDRGQDAGI 377

  Fly   421 RLWKQWALREIFTPIQEQTASLQTVAPGLLELSNYILYRAPVINSISQSYRSVPAYLYTFDYRGE 485
            ..::::.:.....|.:|:..  |||    :||....::..|.         ....||:| |....
Zfish   378 ATFQEYTVNWGDKPNKEKVK--QTV----VELETDYMFLVPT---------QAALYLHT-DNAKS 426

  Fly   486 HHRFGHLSN--------PLPFGVDASLSDDSVYLFPYPPEASRLN--PLDRSLSRALVTMWVNFA 540
            ...|.:|..        ||..|.|.  :|:..|:|. .|.|:.|.  |..|.:|:.::..|.|||
Zfish   427 ARTFSYLFTESSRIPVFPLWMGADH--ADELQYVFG-KPFATPLGYFPRHRDVSKYMIAYWSNFA 488

  Fly   541 TTGVPNPSSG----VWPQATSEYGPFLRFTN--NQQSPLELDPHFGEGIYLPNYRVIYKPTTNFS 599
            .||.||....    .||:.::....:|...|  |:.:..:          :...|::|..||.|:
Zfish   489 QTGDPNKGESKVPVTWPEFSNPGHQYLDINNKMNKNNVKQ----------MLRTRLVYYWTTVFA 543

  Fly   600  599
            Zfish   544  543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 141/563 (25%)
Aes <146..345 CDD:223730 62/218 (28%)
RILP-like <677..>717 CDD:304877
cel.1NP_955901.2 COesterase 25..517 CDD:306613 137/540 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.