DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and CES5A

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001177087.1 Gene:CES5A / 221223 HGNCID:26459 Length:604 Species:Homo sapiens


Alignment Length:625 Identity:165/625 - (26%)
Similarity:244/625 - (39%) Gaps:144/625 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRPDYNDYSDED-----------TRRDWLPEPLKPVPWQSETRYAQPQEAVVQAPEVGQILGISG 75
            ||.|..:|:.:|           ||..|:                |.::..|....|        
Human    41 LRIDVLNYTSKDEGPSAEGPQRNTRLGWI----------------QGKQVTVLGSPV-------- 81

  Fly    76 HKTIANRPVNAFLGIRYGTVGGGLARFQAAQPIGYQGRVNATVQSPN-CAQFPE---LDR--LRL 134
                   |||.|||:.:.....|..||...||......:......|| |.|..|   ||:  |::
Human    82 -------PVNVFLGVPFAAPPLGSLRFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKV 139

  Fly   135 SESRGENVDDCLTLDIYAPEGA---NQLPVLVFVHG-------EMLFDGGSEEAQPDYVLEKDVL 189
            ...:....:|||.|:||||..|   ::|||||:..|       ..:|||.:..|.      :|||
Human   140 HYPKFGVSEDCLYLNIYAPAHADTGSKLPVLVWFPGGAFKTGSASIFDGSALAAY------EDVL 198

  Fly   190 LVSINYRLAPFGFLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNAGQVTLVGQAGGATLAHA 254
            :|.:.|||..|||.:......|||.|..|...||.|:|:|:..|||:...||:.|::.||....:
Human   199 VVVVQYRLGIFGFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSS 263

  Fly   255 LSLSGRAGNLFQQLILQSGTALNPYL--IDNQPLDTLSTFARLARCPPPSINPSAQGLKPLYDCL 317
            |.||..|..||.:.|::||.|:.|||  .|.:..:.|...|...       ..:|...:.|..||
Human   264 LILSPMAKGLFHKAIMESGVAIIPYLEAHDYEKSEDLQVVAHFC-------GNNASDSEALLRCL 321

  Fly   318 ARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLVVGDPLGFLPSHPASLATNSSL-ALPMIIGATK 381
            ...|:.:|      |.|..:....|     ::|.|   .|.|:.|..|.:..:. |:|.|||...
Human   322 RTKPSKEL------LTLSQKTKSFT-----RVVDG---AFFPNEPLDLLSQKAFKAIPSIIGVNN 372

  Fly   382 DASAFIVSRIYDQLARLQSRNVSDYIDVV--LRHTAPPSEHRLWKQWALREIFTPIQEQTASLQT 444
            ....|::. :.:....|...|.|..:.::  :.|..|...|.:     ..|.|    ....||..
Human   373 HECGFLLP-MKEAPEILSGSNKSLALHLIQNILHIPPQYLHLV-----ANEYF----HDKHSLTE 427

  Fly   445 VAPGLLELSNYILYRAPVINSISQSYR---SVPAYLYTFDYRGEHHRFGHLSNPLPFGVDASLSD 506
            :...||:|...:.:..|.:  |:..|.   ..|.|.|.|     .||.....:..|..|.|..:|
Human   428 IRDSLLDLLGDVFFVVPAL--ITARYHRDAGAPVYFYEF-----RHRPQCFEDTKPAFVKADHAD 485

  Fly   507 D------------SVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVPNPSS-GVWP--QAT 556
            :            .:.:|....|..:|      |||.::..|..||.||.||.:. .:||  ..|
Human   486 EVRFVFGGAFLKGDIVMFEGATEEEKL------LSRKMMKYWATFARTGNPNGNDLSLWPAYNLT 544

  Fly   557 SEYGPFLRFTNNQQSPLELDPHFGEGIYLPNYRVIYKPTT 596
            .:|             |:||.:...|..|...||.:..:|
Human   545 EQY-------------LQLDLNMSLGQRLKEPRVDFWTST 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 152/562 (27%)
Aes <146..345 CDD:223730 70/210 (33%)
RILP-like <677..>717 CDD:304877
CES5ANP_001177087.1 COesterase 56..568 CDD:278561 159/605 (26%)
Aes <155..>258 CDD:223730 41/108 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.