DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AADAC

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_001077.2 Gene:AADAC / 13 HGNCID:17 Length:399 Species:Homo sapiens


Alignment Length:399 Identity:83/399 - (20%)
Similarity:134/399 - (33%) Gaps:129/399 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 VNA---TVQSPNCAQFPEL------------------------DRLRLSESRGENVDDCLTLDIY 151
            :||   |:|  |.|.|.||                        :.:.::|::..|:    .:.:|
Human    36 INAHLKTIQ--NLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNI----LVRVY 94

  Fly   152 APEGANQL--PVLVFVHGEMLFDGG---SEEAQPDYVL-------EKDVLLVSINYRLAP-FGFL 203
            .|:..::.  ..|.::||     ||   ...|...|.|       ..|.::||.|||||| :.| 
Human    95 VPKRKSEALRRGLFYIHG-----GGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHF- 153

  Fly   204 SALTDELPGNVALSDLQLALEWLQRNVV--HFGGNAGQVTLVGQAGGATLAHALSLSGRAGNLFQ 266
                     .:...|:..||.|..|..|  .:|.|..::.:.|.:.|..||.|::         |
Human   154 ---------PIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVT---------Q 200

  Fly   267 QLI--------LQSGTALNPYLIDNQPLDTLSTFARLARCPPPSINPSAQGLKPLYDCLARLPTS 323
            ||:        |:..:.:.|.|   ||||.          ..||...::..|......:.|..:.
Human   201 QLLDDPDVKIKLKIQSLIYPAL---QPLDV----------DLPSYQENSNFLFLSKSLMVRFWSE 252

  Fly   324 QLVA--AFEQLLLQNEHLGLTQLGGFKLVVGDPL--------------------------GFLPS 360
            ....  :.|:.:|..:|:.:.....||.|....|                          |||..
Human   253 YFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDV 317

  Fly   361 HPASLAT--NSSLALPMIIGAT------KDASAFIVSRIYDQLARLQSRNVSDYIDVVLRHTAPP 417
            ..|.|..  |....||:....|      :|.....|:|:.:...::...:|.|............
Human   318 RAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLK 382

  Fly   418 SEHRLWKQW 426
            ..|||..|:
Human   383 ISHRLINQY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 83/399 (21%)
Aes <146..345 CDD:223730 50/223 (22%)
RILP-like <677..>717 CDD:304877
AADACNP_001077.2 Aes 33..399 CDD:223730 83/399 (21%)
Abhydrolase_3 107..377 CDD:285143 66/306 (22%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 111..113 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.