DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and AgaP_AGAP010913

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_309781.4 Gene:AgaP_AGAP010913 / 1271035 VectorBaseID:AGAP010913 Length:192 Species:Anopheles gambiae


Alignment Length:178 Identity:65/178 - (36%)
Similarity:93/178 - (52%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TRYAQ-PQEAVVQAPEVGQILGISGHKTIANRPVNAFLGIRYGTVGGGLARFQAAQPIG---YQG 112
            |..|| .|..||....:|.:||..|......||:..|..|:|.....|..||:|  |:.   :.|
Mosquito    23 TSLAQDDQGPVVDIQGLGSVLGTMGETAWTGRPIYQFFNIKYAEAPVGEQRFRA--PLSVLPWSG 85

  Fly   113 RVNATVQSPNCAQFPELDRLRLSESRGENVDDCLTLDIYAPEGANQLPVLVFVHGEMLFDGGSEE 177
            .:|.|.....|.|     |..:|:. ..:.:|||||.:|:.:.....||:::|||.....|.:|.
Mosquito    86 VMNVTAPGRGCPQ-----RRTISQD-DPDAEDCLTLSVYSNDLTANRPVMLYVHGGAFVVGSAER 144

  Fly   178 AQPDYVLEKDVLLVSINYRLAPFGFLSALTDELPGNVALSDLQLALEW 225
            ..|:|:||||::||.|.|||...||||..|:.:|||.|:.|:..:|||
Mosquito   145 FGPEYLLEKDIVLVVIQYRLGTLGFLSTGTEAIPGNAAMYDVLESLEW 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 64/175 (37%)
Aes <146..345 CDD:223730 36/80 (45%)
RILP-like <677..>717 CDD:304877
AgaP_AGAP010913XP_309781.4 Abhydrolase 26..>192 CDD:304388 62/173 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.