DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and LOC107987423

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_016885725.1 Gene:LOC107987423 / 107987423 -ID:- Length:286 Species:Homo sapiens


Alignment Length:291 Identity:65/291 - (22%)
Similarity:117/291 - (40%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 CLARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLVVGDP------LGFLPSHPASLATNSSL--- 371
            ||.:....:|:    :..|:.:.|.|.       :.|||      ||.:......|.|...|   
Human     4 CLRQKTEEELL----ETTLKMKFLSLD-------LQGDPRESQPLLGTVIDGMLLLKTPEELQAE 57

  Fly   372 ----ALPMIIGATKDASAFIVSRIYDQLARLQSRNVSD-YIDVVLRHTAPPSEHRLWKQWAL--- 428
                .:|.::|..|....:::.      .:|.|..:|: .:|   :.||   ...|||.:.|   
Human    58 RNFHTVPYMVGINKQEFGWLIP------MQLMSYPLSEGQLD---QKTA---MSLLWKSYPLVCI 110

  Fly   429 -REIFTPIQEQ-------TASLQTVAPGLLELSNYILYRAPVINSISQSYR--SVPAYLYTFDYR 483
             :|:.....|:       |...:.:   .|:|...:::..|.: .:::::|  ..|.|:|.|.||
Human   111 AKELIPEATEKYLGGTDDTVKKKDL---FLDLIADVMFGVPSV-IVARNHRDAGAPTYMYEFQYR 171

  Fly   484 GEHHRFGHLSNPLPFGVDASLSDD--SVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVPN 546
            ....     |:..|..|.....|:  ||:..|:..|.:....:  .||:.::..|.|||..|.||
Human   172 PSFS-----SDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEI--RLSKMVMKFWANFARNGNPN 229

  Fly   547 PSSGV--WPQATSEYGPFLRFTNNQQSPLEL 575
             ..|:  ||:...:.| :|:...|.|:..:|
Human   230 -GEGLPHWPEYNQKEG-YLQIGANTQAAQKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561 65/291 (22%)
Aes <146..345 CDD:223730 6/28 (21%)
RILP-like <677..>717 CDD:304877
LOC107987423XP_016885725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.