DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glt and gdf10

DIOPT Version :9

Sequence 1:NP_001245946.1 Gene:Glt / 34193 FlyBaseID:FBgn0001114 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_004915891.1 Gene:gdf10 / 100485598 XenbaseID:XB-GENE-5998698 Length:436 Species:Xenopus tropicalis


Alignment Length:79 Identity:16/79 - (20%)
Similarity:33/79 - (41%) Gaps:12/79 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 YEQYGPEG--NENLPET--------DANRNFSEEDREQQQQEQLRREQQEQQEREYQLQLER--E 843
            |:.:.|.|  ::..|.|        |.:...|..|.|....:.:|..:|:..|..|:....:  .
 Frog   230 YDPFQPNGGNSKQAPNTSSESRVKRDTSDLASTHDNELPNIKYVRYSKQDLWENTYKSLKHKLSH 294

  Fly   844 QQEREQQERGQQEP 857
            :::::.||..:..|
 Frog   295 KEKKKAQENAETLP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GltNP_001245946.1 COesterase 55..579 CDD:278561
Aes <146..345 CDD:223730
RILP-like <677..>717 CDD:304877
gdf10XP_004915891.1 TGF_beta_GDF10 325..436 CDD:381664
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.