DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1a and sdf2l1

DIOPT Version :9

Sequence 1:NP_001260265.1 Gene:Sema1a / 34192 FlyBaseID:FBgn0011259 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_001008033.1 Gene:sdf2l1 / 493395 XenbaseID:XB-GENE-970744 Length:218 Species:Xenopus tropicalis


Alignment Length:243 Identity:53/243 - (21%)
Similarity:83/243 - (34%) Gaps:88/243 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GYGWMQVFLLLTVLVIGNQSAWQENIRPKLYVELGPEDVLKFVGNESVVDHFKLVTKDGNSLLIG 110
            |:|  ||||||.:..|             |:...|.|:..::|...|||.            |:.
 Frog     5 GFG--QVFLLLNLCSI-------------LHRGQGSEEDAEYVTCGSVVK------------LLN 42

  Fly   111 ARNTVFNLSIHDL-----VEQQRLVWTSPEDD-TKMCLVKGKDEEACQNYIRIMVVPSPGRLFVC 169
            :|:.| .|..||:     ..||.:......|| .....::||.:..|          |.|....|
 Frog    43 SRHNV-RLHSHDVKYGSGSGQQSVTGVEASDDANSYWRIRGKTDADC----------SRGEPIKC 96

  Fly   170 GTNSFRPMCNTYIISDSN-YTLEATKNGQAVCPYDPRHNSTSVLADNELYSGTVADFSGSDPIIY 233
            |    :.:..|::.:..| :|                |:..|.|::|:..|....:..|.|    
 Frog    97 G----QAVRLTHVNTGKNLHT----------------HHFPSPLSNNQEVSAFGDNGEGDD---- 137

  Fly   234 REPLQTEQYDSLSLNAPNFVSSFTQGDFVYFFFRETAVEFINCGKAIY 281
                         |:|.....|.|      .:.||.:|.|.:.|..:|
 Frog   138 -------------LDAWMVQCSDT------LWEREESVRFKHIGTNVY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1aNP_001260265.1 Sema_1A 91..546 CDD:200498 40/198 (20%)
PSI 545..>579 CDD:214655
sdf2l1NP_001008033.1 PMT1 <49..>209 CDD:224839 34/171 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.