DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1a and Sema3d

DIOPT Version :9

Sequence 1:NP_001260265.1 Gene:Sema1a / 34192 FlyBaseID:FBgn0011259 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_001098103.1 Gene:Sema3d / 246262 RGDID:727939 Length:777 Species:Rattus norvegicus


Alignment Length:637 Identity:196/637 - (30%)
Similarity:320/637 - (50%) Gaps:97/637 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VFLLLTVLVIGNQSAWQENIRPKLYVELGPEDVL------KFVGNESVVDHFK--LVTKDGNSLL 108
            :.|::|||.:......::|| |:|  :|..:|:|      .|:|:...:| |:  |:.::...||
  Rat    23 MMLIVTVLYLPVTETSKQNI-PRL--KLTYKDLLLSNTCIPFLGSSEGLD-FQTLLLDEERGILL 83

  Fly   109 IGARNTVFNLSIHDLVEQ-QRLVWTSPEDDTKMCLVKGKDEEA-CQNYIRIMVVPSPGRLFVCGT 171
            :||::.||.|::.||.:. :::.|.:.::..::|.:.|||... |.|:||::...:...::||||
  Rat    84 LGAKDHVFLLNLVDLNKNFKKIYWPAAKERVELCKLAGKDANTECANFIRVLQPYNKTHVYVCGT 148

  Fly   172 NSFRPMCNTYIISDSN-------YTLEATKNGQAVCPYDPRHNSTSVLADNELYSGTVADFSGSD 229
            .:|.|:|. ||...:|       ..::..::|:..||:||:....||:.|..|||||.:||.|.|
  Rat   149 GAFHPLCG-YIDLGANKEELIFKLDMQNLESGRLKCPFDPQQPFASVMTDEHLYSGTASDFLGKD 212

  Fly   230 PIIYR--------EPLQTEQYDSLSLNAPNFVSSF-------TQGDFVYFFFRETAVEFINCGKA 279
            ....|        ..::|:..:...||...|:.:|       ...|.:||||||::.|.....::
  Rat   213 TAFTRSLGLMQDHHYIRTDISEHYWLNGAKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDRS 277

  Fly   280 IYSRVARVCKWDKGGPHRFRNRWTSFLKSRLNCSIPGD--YPFYFNEIQSASNLVEGQYGSMSSK 342
            |.|||.||||.|.||.....|:||:|||:||.|||||.  ...:|:|:|....|   ......:.
  Rat   278 ILSRVGRVCKNDVGGQRSLINKWTTFLKARLVCSIPGSDGADTHFDELQDIYLL---PTRDERNP 339

  Fly   343 LIYGVFNTPSNSIPGSAVCAFALQDIADTFEGQFKEQTGINSNWLPVNNAKVPDPRPGSCHN--- 404
            ::||||.|.|:...|||||.:::.||...|.|.:..:...:..|:.. :.::|.||||:|.:   
  Rat   340 VVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQY-DGRIPYPRPGTCPSKTY 403

  Fly   405 -----DSRALPDPTLNFIKTHSLMDENVPAFFSQPILVRTSTIYRFTQIAVDAQIKTPGGKTYDV 464
                 .:|..||..::||:.|.:|.::|......|...|.:..||.|||.||..:...|  .|||
  Rat   404 DPLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRLTQIVVDHVVAEDG--QYDV 466

  Fly   465 IFVGTDHGKIIKSVNAESADSADK--VTSVVIEEIDVLTKSEPIRNLEIVRTMQYDQPKDGSYDD 527
            :|:|||.|.::|.|:.    |.:|  :..||:||:.|......|.|:|:  :::..|...||:|.
  Rat   467 MFLGTDIGTVLKVVSI----SKEKWNMEEVVLEELQVFKHPTAILNMEL--SLKQQQLYVGSWDG 525

  Fly   528 GKLIIVTDSQVVAIQLHRCHNDKITSCSECVALQDPYCAWDKIAGKCRSHGAPRWLEENYFYQNV 592
                      :|.:.|||| :....:|::|...:|||||||   |...|..||            
  Rat   526 ----------LVQLSLHRC-DTYGKACADCCLARDPYCAWD---GNACSRYAP------------ 564

  Fly   593 ATGQHAACPSGKINSKDANAGEQKGFRNDMDLLDS-RRQSKDQEIIDNIDKN 643
             |.:..|      ..:|...|:.  .....|:.|| ..::.|:::|..|:.|
  Rat   565 -TSKRRA------RRQDVKYGDP--ITQCWDIEDSISHEAADEKVIFGIEFN 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1aNP_001260265.1 Sema_1A 91..546 CDD:200498 157/492 (32%)
PSI 545..>579 CDD:214655 13/33 (39%)
Sema3dNP_001098103.1 Sema_3D 61..534 CDD:200513 159/496 (32%)
PSI 533..570 CDD:214655 16/53 (30%)
Ig_Sema3 595..686 CDD:409455 4/13 (31%)
Ig strand B 609..613 CDD:409455
Ig strand C 621..625 CDD:409455
Ig strand E 648..652 CDD:409455
Ig strand F 662..667 CDD:409455
Ig strand G 679..682 CDD:409455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153798at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.