DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1a and dok2

DIOPT Version :9

Sequence 1:NP_001260265.1 Gene:Sema1a / 34192 FlyBaseID:FBgn0011259 Length:1131 Species:Drosophila melanogaster
Sequence 2:XP_002932742.2 Gene:dok2 / 100487659 XenbaseID:XB-GENE-982227 Length:416 Species:Xenopus tropicalis


Alignment Length:178 Identity:35/178 - (19%)
Similarity:58/178 - (32%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   854 NSPQQQQQQSQQPHSSSGSSPVMSNSSSSPAPPSSSPSPQESPKNCSYIYRDXLICNTKSMPLIQ 918
            |:.::|..:...|.|...::.::..     .|..|.|.||.|               ....|.||
 Frog   241 NNKKEQVSEEAPPGSRKRTTSLVPK-----GPAVSGPCPQSS---------------VVGKPSIQ 285

  Fly   919 AQSTHAQPHPQSHPHPLPPP-----GPTTPPAQPRARSPMIGRTYAKSMPVTPVQPQSPLAETPS 978
            .:|.:|.|..:...:.|...     ||..|....|.::...|:  |:.:...|..|.:|:.:.|.
 Frog   286 EESEYAVPFDKVAQNLLATGFGGLLGPHIPQQDKRPKARPAGQ--AEPIYDEPGTPHNPVYDEPE 348

  Fly   979 YELYERHSDAATFHFGDEDDDDDDEHDHEDTSSLAMITPPPPYDTPHL 1026
            ....|.....||           |.|:             ..|:.|:|
 Frog   349 VIRSEAWKTQAT-----------DAHE-------------TGYEFPYL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1aNP_001260265.1 Sema_1A 91..546 CDD:200498
PSI 545..>579 CDD:214655
dok2XP_002932742.2 PH-like 7..115 CDD:388408
PH-like 150..244 CDD:388408 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.