DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IDH3A and CG5028

DIOPT Version :9

Sequence 1:NP_005521.1 Gene:IDH3A / 3419 HGNCID:5384 Length:366 Species:Homo sapiens
Sequence 2:NP_001097922.1 Gene:CG5028 / 43102 FlyBaseID:FBgn0039358 Length:402 Species:Drosophila melanogaster


Alignment Length:342 Identity:133/342 - (38%)
Similarity:201/342 - (58%) Gaps:22/342 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    29 GGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPS-EAKESMD--- 89
            ||...||::||.|||||:...|.:||....|||.:|..::.           || |..:.:|   
  Fly    55 GGRHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDID-----------PSTEGNDDLDYAI 108

Human    90 ----KNKMGLKGPLKTPI-AAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENT 149
                :|.:.|||.::|.. :....|.|:.:|...|||.||..|.|..|....:.|:::|.||:||
  Fly   109 TSIKRNGVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVHCKSYPGIPARHHDIDVVLIRQNT 173

Human   150 EGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQK 214
            :|||:.:||..|.|:|:|:|::|...::|:|.:|||:||.|:|..||.:||||||::||||||:.
  Fly   174 DGEYAMLEHESVPGIVESMKVVTVENAERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEV 238

Human   215 CREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIG 279
            ...|.:...:::.|.|.:|..|:..|.:|.||||:.|.||||.|:|::..||:||.|:....|.|
  Fly   239 ANRVHKDYPELEHNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGRNYG 303

Human   280 ANGVAIFE-SVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTK 343
             :..|||| ....|...||||::|||.|::.:::.||.|:|..:||..|:.|.:.||.:....|.
  Fly   304 -DHYAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANVIQEAVYQTIVNDAIRTP 367

Human   344 DLGGNAKCSDFTEEICR 360
            |:||....:|..|.|.:
  Fly   368 DIGGTNSSTDVVENILK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IDH3ANP_005521.1 mito_nad_idh 29..362 CDD:272942 133/342 (39%)
CG5028NP_001097922.1 mito_nad_idh 55..386 CDD:272942 133/342 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53770
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.