DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgp and LYS2

DIOPT Version :9

Sequence 1:NP_001260257.1 Gene:Sgp / 34188 FlyBaseID:FBgn0032055 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_009673.1 Gene:LYS2 / 852412 SGDID:S000000319 Length:1392 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:78/309 - (25%)
Similarity:122/309 - (39%) Gaps:64/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVFVTGGTGFLGKVIIEKLLRSTDVR---RVYLLVRPKKNETVEGRFQ-------AWKDEPVFKI 67
            :|||||.|||||..|:..||..:...   :|:..||.|..|....|.|       .|.::  |..
Yeast   972 NVFVTGVTGFLGSYILADLLGRSPKNYSFKVFAHVRAKDEEAAFARLQKAGITYGTWNEK--FAS 1034

  Fly    68 LLKAKPEALKLVTPISGDCSEPGLGLSDGDRRMVTADVQVIIHSAASIRFVEPLQRALNINTRAT 132
            .:|.          :.||.|:...||||.....:...|.:|||:.|.:.:|.|..:..:.|..:|
Yeast  1035 NIKV----------VLGDLSKSQFGLSDEKWMDLANTVDIIIHNGALVHWVYPYAKLRDPNVIST 1089

  Fly   133 RLMIQLAKEMKGLEAFVHISTAFSNCPSQH---IEERFYPEHLTCPAAKVLEFNETLSPDLLDKM 194
            ..::.||  ..|...|....::.|...:::   :.::...|    ....:||     |.||::. 
Yeast  1090 INVMSLA--AVGKPKFFDFVSSTSTLDTEYYFNLSDKLVSE----GKPGILE-----SDDLMNS- 1142

  Fly   195 APALMGKFPNTYTYTKALAEQVIQMEGQ-DLPICVFRPAIILANFKEPMSGWIDNLHGVVALIYG 258
            |..|.|    .|..:|..||.:|:..|: .|..|:.||..:........|...|.|         
Yeast  1143 ASGLTG----GYGQSKWAAEYIIRRAGERGLRGCIVRPGYVTGASANGSSNTDDFL--------- 1194

  Fly   259 NTYGILRLLYVNPKADAI--------IVPGDYCANVALASGWQVAKNSE 299
                 ||.|..:.:...|        :||.|:.|.|.:|:.....|.:|
Yeast  1195 -----LRFLKGSVQLGKIPDIENSVNMVPVDHVARVVVATSLNPPKENE 1238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgpNP_001260257.1 PLN02996 1..449 CDD:215538 78/309 (25%)
FAR-N_SDR_e 12..333 CDD:187547 78/309 (25%)
FAR_C 367..457 CDD:176924
LYS2NP_009673.1 alpha_am_amid 7..1379 CDD:274582 78/309 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I2873
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.