DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgp and AT3G60060

DIOPT Version :9

Sequence 1:NP_001260257.1 Gene:Sgp / 34188 FlyBaseID:FBgn0032055 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_191565.1 Gene:AT3G60060 / 825176 AraportID:AT3G60060 Length:154 Species:Arabidopsis thaliana


Alignment Length:171 Identity:34/171 - (19%)
Similarity:63/171 - (36%) Gaps:51/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FYKDKSVFVTGGTGFLGKVIIEKLLRSTDVRRVYLLVRPKKNETVEGRFQAWKDEPVFKILLKAK 72
            |...:.:||||                    ::.|:::....|..:.|           :..:..
plant    16 FLARERLFVTG--------------------KIVLVIKANDQEAAKKR-----------LYFQFH 49

  Fly    73 PEALKLVTPISGDCSEPGLGLSDGDRRMVTADVQVIIHSAASIRFVEPL--------------QR 123
            |..|..:.|:..|.:|..||:.......::.::.:||.|||:..|.:.|              ||
plant    50 PSILSKLLPVVEDIAEDNLGVDSETSLKISEEIDIIISSAATTTFDDSLWNFTGPWRIYSDACQR 114

  Fly   124 ALNINTRATRLMIQLAKEMKGLEAFVHIST-----AFSNCP 159
            ..|:..|.:.:.:.: |..|.|:.||.::.     ||...|
plant   115 GNNLRERESDITLSI-KGKKKLKYFVAMAKLYEPYAFFQAP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgpNP_001260257.1 PLN02996 1..449 CDD:215538 34/171 (20%)
FAR-N_SDR_e 12..333 CDD:187547 33/167 (20%)
FAR_C 367..457 CDD:176924
AT3G60060NP_191565.1 NADB_Rossmann 25..>98 CDD:304358 18/103 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3320
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.