| Sequence 1: | NP_001260255.1 | Gene: | Uba4 / 34187 | FlyBaseID: | FBgn0032054 | Length: | 453 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_003959.3 | Gene: | UBA3 / 9039 | HGNCID: | 12470 | Length: | 463 | Species: | Homo sapiens |
| Alignment Length: | 337 | Identity: | 68/337 - (20%) |
|---|---|---|---|
| Similarity: | 110/337 - (32%) | Gaps: | 96/337 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 79 PDFGVQG---QLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSED 140
Fly 141 RCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVML 205
Fly 206 SK------------PLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPP------------PEAVT 246
Fly 247 NC---------------GDG----------------------------------------GVLGA 256
Fly 257 VTGT---IGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCSAQP----- 313
Fly 314 ----LITELINY 321 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Uba4 | NP_001260255.1 | PRK07878 | 56..453 | CDD:181156 | 68/337 (20%) |
| ThiF_MoeB_HesA_family | 71..299 | CDD:238386 | 61/304 (20%) | ||
| RHOD_ThiF | 336..453 | CDD:238784 | |||
| UBA3 | NP_003959.3 | Interaction with UBE2M N-terminus | 53..70 | 5/15 (33%) | |
| Uba3_RUB | 71..368 | CDD:238765 | 58/298 (19%) | ||
| Interaction with UBE2M N-terminus | 157..161 | 1/3 (33%) | |||
| Interaction with UBE2M N-terminus | 192..217 | 5/24 (21%) | |||
| Interaction with NEDD8 | 227..229 | 0/1 (0%) | |||
| Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 | 242..248 | 1/5 (20%) | |||
| Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 | 292..295 | 0/2 (0%) | |||
| Interaction with UBE2M N-terminus | 331..338 | 0/7 (0%) | |||
| Interaction with NEDD8 | 352..357 | 0/4 (0%) | |||
| Interaction with UBE2M core domain | 368..463 | 4/21 (19%) | |||
| E2_bind | 376..461 | CDD:400951 | 2/13 (15%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0476 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||