DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and UBA3

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_015391.1 Gene:UBA3 / 856179 SGDID:S000006270 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:41/171 - (23%)
Similarity:69/171 - (40%) Gaps:23/171 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VLIVGLGGLGCPAAQYLAAAG-CGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLEL 157
            :|::|.|||||...:.|.... ...:.:||.|.:|.:|.:||.|..:...|..||:.|...:...
Yeast     5 ILVLGAGGLGCEILKNLTMLSFVKQVHIVDIDTIELTNLNRQFLFCDKDIGKPKAQVAAQYVNTR 69

  Fly   158 NPHCEIQCHSRML------YPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSK--------P 208
            .|..|:..|.:.|      :..:...||.|.|.:      .|.|: :::..|.|:.        |
Yeast    70 FPQLEVVAHVQDLTTLPPSFYKDFQFIISGLDAI------EPRRF-INETLVKLTLESNYEICIP 127

  Fly   209 LVSGSALKMDGQLTVYNYANGPCYRC-IFPVPPPPEAVTNC 248
            .:.|....:.|.:.........|:.| |..:|...:.|..|
Yeast   128 FIDGGTEGLKGHVKTIIPGITACWECSIDTLPSQQDTVPMC 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 41/171 (24%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 41/171 (24%)
RHOD_ThiF 336..453 CDD:238784
UBA3NP_015391.1 Uba3_RUB 4..294 CDD:238765 41/171 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.