DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Uba7

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_076227.1 Gene:Uba7 / 74153 MGIID:1349462 Length:977 Species:Mus musculus


Alignment Length:316 Identity:74/316 - (23%)
Similarity:110/316 - (34%) Gaps:79/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEQEVVGNDLESPDVAVHTKLTNDDIARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQ 108
            ||.|.:   |.||:......      .||..|:.:  ||...|.||.:...|:||.|.:||...:
Mouse   383 PEDETL---LPSPEDCQPRN------CRYDGQIAV--FGTDLQEKLSDQHYLLVGAGAIGCEMLK 436

  Fly   109 YLAAAGC-----GHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPH-------C 161
            ..|..|.     |.:.:.|.|.:||||..||.|.........|||.|..|...|||.       |
Mouse   437 VFALVGLGVRANGGVTVADMDYIERSNLSRQFLFRPKDVRRPKAEVAAAAAHRLNPDLRATPYTC 501

  Fly   162 EIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKMDGQLTVYNY 226
            .:...:..:|..:....:.|   |:...|:...|:.::..|....|||:........|..:|:..
Mouse   502 PLDPTTEDIYDDSFFSRVNG---VVAALDSFQARHYVAARCTHYLKPLLEAGTQGTWGSASVFVP 563

  Fly   227 ANGPCYRCIFPVPPPPEAVTN------CGDGGVLGAVTGTIGAMQALEAIKVIVGMGDVLAGRLL 285
            .....||     .|..:|.:.      |....:..::..::...|                    
Mouse   564 YVTEAYR-----GPASDAASEDAPYPVCTLRHIPSSMEHSVQWAQ-------------------- 603

  Fly   286 IFDGGSGVFRNIRIRSKRPNCHMCSAQPLITELIN-YEMFC-GMHATDKNNPMLLL 339
              |...|:||                  |.||.|| |:..| .:.|||:...:.||
Mouse   604 --DQFEGLFR------------------LSTETINCYQQTCTSLSATDRTETLALL 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 69/304 (23%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 56/245 (23%)
RHOD_ThiF 336..453 CDD:238784 2/4 (50%)
Uba7NP_076227.1 Ube1 1..961 CDD:273603 74/316 (23%)
Ube1_repeat1 5..386 CDD:238768 2/2 (100%)
E1_4HB 254..317 CDD:292809
E1_enzyme_family 421..932 CDD:304554 60/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.