DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and UBA1

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_016885266.1 Gene:UBA1 / 7317 HGNCID:12469 Length:1109 Species:Homo sapiens


Alignment Length:204 Identity:55/204 - (26%)
Similarity:83/204 - (40%) Gaps:29/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LTNDDIA----RYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLA--AAGCGHLG--- 119
            ||.|...    ||..|:.:  ||...|.||......:||.|.:||...:..|  ..|||..|   
Human   490 LTEDKCLQRQNRYDGQVAV--FGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEII 552

  Fly   120 LVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAM----HIIR 180
            :.|.|.:|:||.:||.|.........|:::|..|:.::|||..:..|...:.|....    ...:
Human   553 VTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQ 617

  Fly   181 GYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKMDGQLTVY------NYANGPCYRCIFPVP 239
            ..|.|.:..|||..|..:...||...|||:....|...|.:.|.      :|::..        .
Human   618 NLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQ--------D 674

  Fly   240 PPPEAVTNC 248
            ||.:::..|
Human   675 PPEKSIPIC 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 55/204 (27%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 52/193 (27%)
RHOD_ThiF 336..453 CDD:238784
UBA1XP_016885266.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.