DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Uba5

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_079968.2 Gene:Uba5 / 66663 MGIID:1913913 Length:403 Species:Mus musculus


Alignment Length:378 Identity:90/378 - (23%)
Similarity:141/378 - (37%) Gaps:97/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YSRQLILPDFG-VQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQI 135
            |||.:.|...| |....|::..:|.|||:||:|...|:.|...|.|.|.|.|||:||.:|.:| :
Mouse    51 YSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNR-L 114

  Fly   136 LHSEDRCGMSKAESARIALLELNPHCEIQCHSRML-----YPHNAMHIIRG-------YDVVLDC 188
            .....:.|:||..:|...|..:||....:.|:..:     :.|....|..|       .|:||.|
Mouse   115 FFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVLSC 179

  Fly   189 TDNVPTRYLLSDACVMLSKP-LVSG-SALKMDGQLTVYNYANGPCYRCIFPVPPPPEAVTNCGD- 250
            .||...|..::.||..|.:. :.|| |...:.|.:.:.......|:.|    .||....:|..: 
Mouse   180 VDNFEARMAINTACNELGQTWMESGVSENAVSGHIQLMIPGESACFAC----APPLVVASNIDEK 240

  Fly   251 ----GGVLGA----VTGTIGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCH 307
                .||..|    ..|.:..:.....:|.::..|.|  ...|.::.....|..:.:: ..|.| 
Mouse   241 TLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTV--SFYLGYNAMQDFFPTMFMK-PNPQC- 301

  Fly   308 MCSAQPLITELINYEMFCGMHATDKNNPMLLLSTDERLSVEDYQQKIQAQPHLLIDVRPTAEFEI 372
                                  .|||.         |...|:|:::..|        .||.|.|.
Mouse   302 ----------------------DDKNC---------RKQQEEYKKRAAA--------LPTQEAEP 327

  Fly   373 CQLPEAVNVPLVEILDDSYLKRLGKQLEDKELPIVLVCRRGNDSQIAVQHLRN 425
            .:..|.|:                   ||.|..|.||      |:::.:.|:|
Mouse   328 QEEAEVVH-------------------EDNEWGIELV------SEVSEEELKN 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 90/378 (24%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 66/250 (26%)
RHOD_ThiF 336..453 CDD:238784 19/90 (21%)
Uba5NP_079968.2 ThiF_MoeB_HesA_family 50..293 CDD:238386 66/248 (27%)
ThiF 51..307 CDD:279270 71/295 (24%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.