DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and nae1

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_956793.1 Gene:nae1 / 573336 ZFINID:ZDB-GENE-040426-1552 Length:533 Species:Danio rerio


Alignment Length:88 Identity:27/88 - (30%)
Similarity:40/88 - (45%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQI 135
            ||.|||.|  :|..||..|:|:.|.::.....|....:.|...|.|...:||..:|...:.....
Zfish    11 RYDRQLRL--WGDHGQEALENAHVCLINATASGTEILKNLVLPGIGAFTIVDGHKVSGEDVGNNF 73

  Fly   136 LHSEDRCGMSKAESARIALLELN 158
            ..|....|.::|::|...|.|||
Zfish    74 FLSSSAIGKNRAQAATELLQELN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 27/88 (31%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 27/88 (31%)
RHOD_ThiF 336..453 CDD:238784
nae1NP_956793.1 ThiF 6..>164 CDD:223552 27/88 (31%)
APPBP1_RUB 10..531 CDD:238770 27/88 (31%)
Interaction with uba3. /evidence=ECO:0000250 330..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.