DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and UBA6

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_060697.4 Gene:UBA6 / 55236 HGNCID:25581 Length:1052 Species:Homo sapiens


Alignment Length:268 Identity:63/268 - (23%)
Similarity:100/268 - (37%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KLKNSSVLIVGLGGLGCPAAQYLAAAGCG---HLGLV---DYDEVERSNFHRQILHSEDRCGMSK 146
            ||:|.::.:||.|.:||...:..|..|.|   ..|::   |.|.:|:||.:||.|.........|
Human   457 KLQNLNIFLVGCGAIGCEMLKNFALLGVGTSKEKGMITVTDPDLIEKSNLNRQFLFRPHHIQKPK 521

  Fly   147 AESARIALLELNPHCEIQCHSRMLYP-----HNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLS 206
            :.:|..|.|::|...:|..|...:.|     :|.....: .||::...|||..|..:...|:...
Human   522 SYTAADATLKINSQIKIDAHLNKVCPTTETIYNDEFYTK-QDVIITALDNVEARRYVDSRCLANL 585

  Fly   207 KPLVSGSALKMDGQLTV--------YNYANGPCYRCIFPVPPPPEAVTNCGDGGVLGAVTGTI-- 261
            :||:....:...|...|        ||     .:|     .||.|.:..|.......|:..||  
Human   586 RPLLDSGTMGTKGHTEVIVPHLTESYN-----SHR-----DPPEEEIPFCTLKSFPAAIEHTIQW 640

  Fly   262 ------------------------GAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSK 302
                                    .|.:.|:.|:         :|..|     .|.|:.|::.|:
Human   641 ARDKFESSFSHKPSLFNKFWQTYSSAEEVLQKIQ---------SGHSL-----EGCFQVIKLLSR 691

  Fly   303 RP-NCHMC 309
            || |...|
Human   692 RPRNWSQC 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 63/268 (24%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 58/255 (23%)
RHOD_ThiF 336..453 CDD:238784
UBA6NP_060697.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Ube1 38..1046 CDD:273603 63/268 (24%)
Ube1_repeat1 43..432 CDD:238768
E1_4HB 299..361 CDD:292809
Ube1_repeat2 462..1005 CDD:238767 60/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.