DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and uba5

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001004790.1 Gene:uba5 / 448010 XenbaseID:XB-GENE-955661 Length:399 Species:Xenopus tropicalis


Alignment Length:413 Identity:100/413 - (24%)
Similarity:169/413 - (40%) Gaps:63/413 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKREIAELRAALNQKEQCLRELDSLFSFATRPEQEVVGNDLESPDVAVHTKLTNDDIARYSRQLI 77
            :::.|.|||:.:::.|:.|..:       ...||...|:..:...::.....:|.    |||.:.
 Frog     1 MEKLIEELRSRVSELEEELHRV-------RNGEQVHEGHRAKINTMSAEVVDSNP----YSRLMA 54

  Fly    78 LPDFG-VQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDR 141
            |...| |:...|::..:|.:||:||:|...|:.|...|.|.|.|.|||:||.:|.:| :.....:
 Frog    55 LKRMGIVEDYEKIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNR-LFFQPHQ 118

  Fly   142 CGMSKAESARIALLELNPHCEIQCHSRML-----YPHNAMHIIRG-------YDVVLDCTDNVPT 194
            .|:||.|:|...|..:||..:.:.|:..:     :.|....|.:|       .|:||.|.||...
 Frog   119 AGLSKVEAAEHTLRNINPDVQFEVHNYNITTLDNFQHFMDRISKGGLKEGTPVDLVLSCVDNFEA 183

  Fly   195 RYLLSDACVMLSKP-LVSG-SALKMDGQLTVYNYANGPCYRCIFPVPPPPEAVTNCGD-----GG 252
            |..::.||..|.:. :.|| |...:.|.:.:.......|:.|    .||.....|..:     .|
 Frog   184 RMAINTACNELVQIWMESGVSENAVSGHIQLIKPGETACFAC----APPLVVAANIDEKTLKREG 244

  Fly   253 VLGA----VTGTIGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNC--HMCSA 311
            |..|    ..|.:..|.....:|.::..|.|  ...|.::.....|..:.:: ..|.|  ..|..
 Frog   245 VCAASLPTTMGVVAGMLVQNVLKYLLNFGTV--SFYLGYNAMQDFFPTMAMK-PNPQCGDKYCRK 306

  Fly   312 QPLITELINYEMFCGMHATDKNNPMLLLSTDERLSVEDYQQKIQAQPHLLIDVRPTAEFEICQLP 376
            |       ..|......|..|..|:::  .:|.:..||....|:....:..:....|...:.:||
 Frog   307 Q-------QEEFKLKEAARPKQEPIVV--KEEEIVHEDNDWGIELVSEVSEEELKAASGPVPELP 362

  Fly   377 E----AVNVPLVE-----ILDDS 390
            |    |..||:.|     |::||
 Frog   363 EGIKVAYTVPITEPTSGFIVEDS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 91/370 (25%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 67/251 (27%)
RHOD_ThiF 336..453 CDD:238784 15/64 (23%)
uba5NP_001004790.1 ThiF_MoeB_HesA_family 48..293 CDD:238386 67/255 (26%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 331..343 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.