DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Uba2

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster


Alignment Length:147 Identity:44/147 - (29%)
Similarity:71/147 - (48%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIA 153
            :|.|.||:||.||:||...:.|..:|...:.::|.|.::.||.:||.|...:..|.|||..||.:
  Fly    17 VKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARES 81

  Fly   154 LLELNPHCEIQC-HSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKM 217
            .|..||..:|.. |..:......::..:.:|:||...||...|..::..|:....||:.......
  Fly    82 ALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDNRAARNHVNRMCLNADVPLIESGTAGY 146

  Fly   218 DGQLTVYNYANGPCYRC 234
            :||:.:.......||.|
  Fly   147 NGQVELIKRGLTQCYEC 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 44/147 (30%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 44/147 (30%)
RHOD_ThiF 336..453 CDD:238784
Uba2NP_524756.2 ThiF 7..>177 CDD:279270 44/147 (30%)
Uba2_SUMO 21..459 CDD:238766 42/143 (29%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.