DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Aos1

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster


Alignment Length:135 Identity:36/135 - (26%)
Similarity:65/135 - (48%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DLESPDVAVHTKLTNDDIARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCG 116
            |:::.:.||  :||..:...|.||:.|  :|::.|.:|:.:.:||.||.|||....:.:..:|..
  Fly     4 DMDTSETAV--ELTEAENELYDRQIRL--WGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVN 64

  Fly   117 HLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAMHIIRG 181
            .:.|:|..:|...:|..|.|...:....::||::......|||..:|......| ..........
  Fly    65 SVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPL-KEKTSEFFGQ 128

  Fly   182 YDVVL 186
            :|||:
  Fly   129 FDVVV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 35/131 (27%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 31/116 (27%)
RHOD_ThiF 336..453 CDD:238784
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 31/118 (26%)
ThiF 22..>167 CDD:279270 31/115 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.