DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and uba3

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_998632.1 Gene:uba3 / 406776 ZFINID:ZDB-GENE-040426-2825 Length:462 Species:Danio rerio


Alignment Length:412 Identity:92/412 - (22%)
Similarity:137/412 - (33%) Gaps:121/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PDFGVQG---QLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSED 140
            |||....   |..|....:|::|.|||||...:.||.:|..|:.:||.|.::.||.:||.|....
Zfish    53 PDFEASTESLQFLLDTCKILVIGAGGLGCELLKDLALSGFRHIHVVDMDTIDVSNLNRQFLFRPK 117

  Fly   141 RCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTR-----YLLS- 199
            ..|..|||.|...:.:..|.|.:..|.:.:...:.. ..|.:.:|:...|:|..|     .||| 
Zfish   118 DVGRPKAEVAADFVNDRVPGCSVVPHFKKIQDLDET-FYRQFHIVVCGLDSVIARRWMNGMLLSL 181

  Fly   200 ----DACVMLSK--PLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPP------------PEAVT 246
                |..:..|.  ||:.|......|...|.......|..|...:.||            |....
Zfish   182 LIYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPE 246

  Fly   247 NC---------------GDGGVLGA---------------------VTG---------------- 259
            :|               |||.||..                     :||                
Zfish   247 HCVEYVRMLLWPKEKPFGDGVVLDGDDPKHIQWVYQKSLERAAEFNITGVTYRLTQGVVKRIIPA 311

  Fly   260 ------TIGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCSAQP----- 313
                  .|.|..|.|..|:... ..|.....|:|:...|::.......::.||..||..|     
Zfish   312 VASTNAVIAAACATEVFKIATS-AYVPLNNYLVFNDVDGLYTYTFEAERKENCSACSQVPQDMQF 375

  Fly   314 -----------LITELINYEMFCGMHAT--DKNNPMLLLSTDERLSVEDYQQKIQAQPHL----- 360
                       .:||..:.:|......|  |..|..|.|.|  ..|:|:     :.:|:|     
Zfish   376 TPSAKLQEVLDYLTENASLQMKSPAITTTLDGKNKTLYLQT--VASIEE-----RTRPNLSKTLK 433

  Fly   361 ---LIDVRPTAEFEICQLPEAV 379
               |:|.:..|..:: ..|:.|
Zfish   434 ELGLVDGQELAVADV-TTPQTV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 92/412 (22%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 69/304 (23%)
RHOD_ThiF 336..453 CDD:238784 12/52 (23%)
uba3NP_998632.1 Interaction with ube2m N-terminus. /evidence=ECO:0000250 52..69 5/15 (33%)
ThiF 66..>240 CDD:279270 47/174 (27%)
Uba3_RUB 70..367 CDD:238765 66/298 (22%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 156..160 1/3 (33%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 191..216 6/24 (25%)
Interaction with nedd8. /evidence=ECO:0000250 226..228 0/1 (0%)
Interaction with nae1. /evidence=ECO:0000250 241..247 1/5 (20%)
Interaction with nae1. /evidence=ECO:0000250 291..294 0/2 (0%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 330..337 0/7 (0%)
Interaction with nedd8. /evidence=ECO:0000250 351..356 0/4 (0%)
Interaction with ube2m core domain. /evidence=ECO:0000250 367..462 20/96 (21%)
E2_bind 375..460 CDD:285976 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.