DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Atg7

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster


Alignment Length:221 Identity:54/221 - (24%)
Similarity:87/221 - (39%) Gaps:56/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQIL--HSE 139
            ::||..::   .:..:..|:.|.|.|||..|:.|.:.|..|:.|:|..:|..||..||.|  |::
  Fly   328 LVPDLNLE---IISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHAD 389

  Fly   140 DRCG-MSKAESARIALLELNPHCEIQCH-----------SRMLYPHNAMH------IIRGYDVVL 186
            ...| ..||.:|...|.|:||..|...:           ...|......|      :::.:||:.
  Fly   390 AVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIF 454

  Fly   187 DCTDNVPTRYL--LSDACVMLSKPLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPPPEAVTNCG 249
            ..||:..:|:|  |..|.   .:.:|..:||..|..|.:   .:|...:             ..|
  Fly   455 LLTDSRESRWLPTLLGAA---KEKIVINAALGFDSYLVM---RHGTTRK-------------EAG 500

  Fly   250 DGGVLGAVTGTIGAMQALEAIKVIVG 275
            |.|            |.:|.:|.|.|
  Fly   501 DDG------------QEIEGLKCING 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 54/221 (24%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 54/221 (24%)
RHOD_ThiF 336..453 CDD:238784
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 54/221 (24%)
Apg7 341..658 CDD:238763 52/205 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.