DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Sae1

DIOPT Version :10

Sequence 1:NP_609240.2 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001012063.1 Gene:Sae1 / 308384 RGDID:1306098 Length:349 Species:Rattus norvegicus


Alignment Length:101 Identity:32/101 - (31%)
Similarity:58/101 - (57%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LTNDDIARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVER 128
            ::.::.|:|.||:.|  :|::.|.:|:.|.|||||:.|||...|:.|..||...|.::|:::|..
  Rat    14 ISEEEAAQYDRQIRL--WGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSP 76

  Fly   129 SNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQ 164
            .:...|.|......|.::||::......|||..:::
  Rat    77 EDLGAQFLIRTGSVGQNRAEASLERAQNLNPMVDVK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_609240.2 ThiF 65..311 CDD:440244 32/100 (32%)
RHOD_ThiF 336..453 CDD:238784
Sae1NP_001012063.1 Aos1_SUMO 19..344 CDD:238769 32/96 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.