DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Uba6

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001100683.1 Gene:Uba6 / 305268 RGDID:1308324 Length:1053 Species:Rattus norvegicus


Alignment Length:250 Identity:68/250 - (27%)
Similarity:101/250 - (40%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KLKNSSVLIVGLGGLGCPAAQYLAAAGCG---HLGLV---DYDEVERSNFHRQILHSEDRCGMSK 146
            ||:|.::.:||.|.:||...:..|..|.|   ..|:|   |.|.:|:||.:||.|.........|
  Rat   457 KLQNLNIFLVGCGAIGCEMLKNFALLGVGTGREKGMVTVTDPDLIEKSNLNRQFLFRPHHIQKPK 521

  Fly   147 AESARIALLELNPHCEIQCHSRMLYPHN----AMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSK 207
            :.:|..|.|::||..:|..|...:.|..    :.......|:|:...|||..|..:...|:...:
  Rat   522 SYTAAEATLKINPQLKIDAHLNKVCPATESTYSDEFYNKQDIVITALDNVEARRYVDSRCLANLR 586

  Fly   208 PLVSGSALKMDG-------QLT-VYNYANGPCYRCIFPVPPPPEAVTNCGDGGVLGAVTGTI-GA 263
            ||:....:...|       ||| .||     .:|     .||.|.:..|.......||..|| .|
  Rat   587 PLLDSGTMGTKGHTEIIVPQLTESYN-----SHR-----DPPEEEIPFCTLKSFPAAVEHTIQWA 641

  Fly   264 MQALEAI------------KVIVGMGDVLAGRLLIFDGGS--GVFRNIRIRSKRP 304
            ....|:.            :......|||.   .|.:|.|  |.|:.|::.|:||
  Rat   642 RDKFESSFSHKPSLFNKFWQAYPSAEDVLQ---KIQNGQSLEGCFQVIKLLSRRP 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 67/249 (27%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 65/243 (27%)
RHOD_ThiF 336..453 CDD:238784
Uba6NP_001100683.1 Ube1 38..1046 CDD:273603 67/249 (27%)
Ube1_repeat1 43..428 CDD:238768
E1_4HB 298..358 CDD:292809
Ube1_repeat2 462..1005 CDD:238767 64/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.