DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and ula-1

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001348740.1 Gene:ula-1 / 266650 WormBaseID:WBGene00006735 Length:543 Species:Caenorhabditis elegans


Alignment Length:94 Identity:31/94 - (32%)
Similarity:50/94 - (53%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DDIARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNF 131
            |...||.||:.|  :|.:||..:.::|..::|...|.....:.|..||.....:||..:||:::.
 Worm     5 DPSTRYDRQVRL--WGEEGQASIGSTSACVLGSDSLATEILKSLVLAGVQSFYVVDDAKVEQADI 67

  Fly   132 HRQ-ILHSEDRCGMSKAESARIALLELNP 159
            .:. .||::| .|.|:||:....|.||||
 Worm    68 GQNFFLHADD-IGRSRAEATLEKLTELNP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 31/94 (33%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 30/90 (33%)
RHOD_ThiF 336..453 CDD:238784
ula-1NP_001348740.1 APPBP1_RUB 8..541 CDD:238770 30/91 (33%)
E1_enzyme_family <443..541 CDD:304554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.