DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Nae1

DIOPT Version :10

Sequence 1:NP_609240.2 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_659180.1 Gene:Nae1 / 234664 MGIID:2384561 Length:534 Species:Mus musculus


Alignment Length:88 Identity:23/88 - (26%)
Similarity:40/88 - (45%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQI 135
            :|.|||.|  :|..||..|:::.|.::.....|....:.|...|.|...::|.:.|...:.....
Mouse    12 KYDRQLRL--WGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNLVSGEDAGNNF 74

  Fly   136 LHSEDRCGMSKAESARIALLELN 158
            ...:...|.::|::|...|.|||
Mouse    75 FLQKSSIGKNRAQAAMEFLQELN 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_609240.2 ThiF 65..311 CDD:440244 23/88 (26%)
RHOD_ThiF 336..453 CDD:238784
Nae1NP_659180.1 APPBP1_RUB 11..532 CDD:238770 23/88 (26%)
Interaction with UBA3. /evidence=ECO:0000250 331..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.