DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and aos-1

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_505604.2 Gene:aos-1 / 179409 WormBaseID:WBGene00000142 Length:350 Species:Caenorhabditis elegans


Alignment Length:96 Identity:32/96 - (33%)
Similarity:51/96 - (53%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQ 134
            |.|.||:.|  :|::.|.|::||.|||:|...||...|:.|:.||...:.|||:..|:.......
 Worm    16 AIYDRQIRL--WGMEAQNKIRNSKVLIIGGKQLGAEVAKTLSLAGVDEMHLVDHRLVDTEEIGMN 78

  Fly   135 ILH--SEDRCGMSKAESARIALLELNPHCEI 163
            .|:  |.|...|:|..::...|..||.:.::
 Worm    79 FLYDASVDNSKMTKWAASYNFLYNLNRNVKL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 32/96 (33%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 31/95 (33%)
RHOD_ThiF 336..453 CDD:238784
aos-1NP_505604.2 E1-1_like 17..345 CDD:238762 31/95 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.