DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and Uba3

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_476553.1 Gene:Uba3 / 117553 RGDID:621084 Length:462 Species:Rattus norvegicus


Alignment Length:337 Identity:69/337 - (20%)
Similarity:110/337 - (32%) Gaps:96/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PDFGVQG---QLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSED 140
            |||....   |..|....||::|.|||||...:.||.:|...:.::|.|.::.||.:||.|....
  Rat    54 PDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPK 118

  Fly   141 RCGMSKAESARIALLELNPHCEIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVML 205
            ..|..|||.|...|.:..|:|.:..|...:...|.. ..|.:.:::...|::..|..::...:.|
  Rat   119 DVGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDT-FYRQFHIIVCGLDSIIARRWINGMLISL 182

  Fly   206 SK------------PLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPP------------PEAVT 246
            ..            ||:.|......|...|.......|..|...:.||            |....
  Rat   183 LNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPE 247

  Fly   247 NC---------------GDG----------------------------------------GVLGA 256
            :|               |||                                        .::.|
  Rat   248 HCIEYVRMLQWPKEQPFGDGVPLDGDDPEHIQWIFQKSVERASQYNIRGVTYRLTQGVVKRIIPA 312

  Fly   257 VTGT---IGAMQALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCSAQP----- 313
            |..|   |.|:.|.|..|:... ..:.....|:|:...|::.......::.||..||..|     
  Rat   313 VASTNAVIAAVCATEVFKIATS-AYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQF 376

  Fly   314 ----LITELINY 321
                .:.|:::|
  Rat   377 SPSAKLQEVLDY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 69/337 (20%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 62/304 (20%)
RHOD_ThiF 336..453 CDD:238784
Uba3NP_476553.1 Interaction with UBE2M N-terminus. /evidence=ECO:0000250 53..70 5/15 (33%)
Uba3_RUB 71..368 CDD:238765 59/298 (20%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 157..161 1/3 (33%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 192..217 5/24 (21%)
Interaction with NEDD8. /evidence=ECO:0000250 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000250 242..248 1/5 (20%)
Interaction with NAE1. /evidence=ECO:0000250 292..295 0/2 (0%)
Interaction with UBE2M N-terminus. /evidence=ECO:0000250 331..338 0/7 (0%)
Interaction with NEDD8. /evidence=ECO:0000250 352..357 0/4 (0%)
Interaction with UBE2M core domain. /evidence=ECO:0000250 368..462 4/21 (19%)
E2_bind 376..461 CDD:400951 2/13 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.