DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba4 and uba7

DIOPT Version :9

Sequence 1:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_005155933.1 Gene:uba7 / 100001302 ZFINID:ZDB-GENE-121120-4 Length:1016 Species:Danio rerio


Alignment Length:194 Identity:60/194 - (30%)
Similarity:83/194 - (42%) Gaps:30/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEQE--VVGNDLESPDVAVHTKLTNDDIARYSRQLILPDFGVQGQLKLKNSSVLIVGLGGLGCPA 106
            |::|  |:..|..:|         .|  :||..|:.:  ||...|.|||.....:||.|.:||..
Zfish   390 PQEEGGVLSEDACAP---------RD--SRYDGQIAV--FGSDFQNKLKKQKYFLVGAGAIGCEL 441

  Fly   107 AQYLAAAGC-----GHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEI--- 163
            .:..|..|.     |.:.:.|.|.:||||.:||.|......|..|:|:|..|:.|:||...|   
Zfish   442 LKNFALIGLGAGEGGSITVTDMDSIERSNLNRQFLFRSQDIGRPKSEAAAEAVKEMNPFMNIIAQ 506

  Fly   164 ---QC-HSRMLYPHNAMHIIRGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSGSALKMDGQLTV 223
               .| .:..:|.|:   ...|.|.|....|||..|..|...||...||::.|..|...|...|
Zfish   507 QNRVCAETEEVYTHS---FYTGLDGVAAALDNVDARVYLDQCCVRNKKPMLEGGTLGSKGHTMV 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 56/180 (31%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 54/165 (33%)
RHOD_ThiF 336..453 CDD:238784
uba7XP_005155933.1 Ube1 5..1013 CDD:273603 60/194 (31%)
Ube1_repeat1 10..393 CDD:238768 1/2 (50%)
E1_4HB 258..326 CDD:292809
E1_enzyme_family 428..970 CDD:304554 45/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.