DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL51 and mrpl51

DIOPT Version :10

Sequence 1:NP_609239.1 Gene:mRpL51 / 34186 FlyBaseID:FBgn0032053 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001013494.1 Gene:mrpl51 / 797002 ZFINID:ZDB-GENE-050320-40 Length:124 Species:Danio rerio


Alignment Length:112 Identity:38/112 - (33%)
Similarity:60/112 - (53%) Gaps:8/112 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KIFKSGLLPHVDNGQKLPMPVYRPKNAWSKKRALFGQNDYIDILGNDRLHPVKVLYSLPSWLRGV 121
            ::|.:|....:   :...:|..:..:.|::||::||..|.|.|||:.:.|| |.:...|.|:||.
Zfish    19 RLFSTGSCARI---RMHAIPKLKEVDRWTEKRSMFGVYDNIGILGDFKAHP-KDMIRGPVWVRGF 79

  Fly   122 SGNEYQVLLRKRKLLEKSKYPIARPTKWREMEKRILYLYKFLNRKTK 168
            .|||.|.|||||.::........|    ..::|||.:||:..||..|
Zfish    80 RGNELQRLLRKRNMVGDRMMTEDR----HNLQKRISHLYRRFNRHGK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL51NP_609239.1 MRP-L51 75..168 CDD:463021 35/92 (38%)
mrpl51NP_001013494.1 MRP-L51 34..122 CDD:463021 35/92 (38%)

Return to query results.
Submit another query.